DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12516 and ALDH1L1

DIOPT Version :10

Sequence 1:NP_651615.2 Gene:CG12516 / 43370 FlyBaseID:FBgn0039577 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001257293.1 Gene:ALDH1L1 / 10840 HGNCID:3978 Length:912 Species:Homo sapiens


Alignment Length:171 Identity:37/171 - (21%)
Similarity:68/171 - (39%) Gaps:50/171 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ITRQMVQILP--SVMVGRITLPDIIEDAIKPPTEDINFEEKSNENEVEDNTEKSEAVSESEKEVI 68
            |.:.:|.:||  ..:||: .|.|      .|....|.|   :...||..:..||.|:|..:|..:
Human   628 IPKGVVNVLPGSGSLVGQ-RLSD------HPDVRKIGF---TGSTEVGKHIMKSCAISNVKKVSL 682

  Fly    69 EVSEEPKEEEVKYAWNAPCMMVIFEDGDVNCALHHLVESLQDPFALDAVAV--ILVQEALAEEIE 131
            |:..:           :|  ::||.|.|:|.|:...:.|:......:.:|.  :.|::::.:|..
Human   683 ELGGK-----------SP--LIIFADCDLNKAVQMGMSSVFFNKGENCIAAGRLFVEDSIHDEFV 734

  Fly   132 NRVKILMKPLDARVANHPCYKRTLMKIDELRPKTIIGPSDR 172
            .||                       ::|:|...:..|.||
Human   735 RRV-----------------------VEEVRKMKVGNPLDR 752

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12516NP_651615.2 DUF1487 82..298 CDD:254173 18/93 (19%)
ALDH1L1NP_001257293.1 FMT_core_FDH_N 11..213 CDD:187716
FDH_Hydrolase_C 216..316 CDD:187731
ALDH_F1L_FTFDH 427..912 CDD:143458 37/171 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.