DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-14L and AT5G25450

DIOPT Version :10

Sequence 1:NP_651614.1 Gene:UQCR-14L / 43369 FlyBaseID:FBgn0039576 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_197927.1 Gene:AT5G25450 / 832619 AraportID:AT5G25450 Length:122 Species:Arabidopsis thaliana


Alignment Length:81 Identity:34/81 - (41%)
Similarity:47/81 - (58%) Gaps:4/81 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 QYGLYRDDCLYE---NEDVAEAVRRLPRKLYDERNYRILRALHLSMTKTILPKEQWTKYEEDIKY 89
            :|||..|| ||:   :.|:.||:.||||::.|.||.|::||:.|||....||............|
plant    30 RYGLRYDD-LYDPLYDLDIKEALNRLPREIVDARNQRLMRAMDLSMKHEYLPDNLQAVQTPFRSY 93

  Fly    90 LEPYLNEVQKEREERE 105
            |:..|..|::||.|||
plant    94 LQDMLALVKRERAERE 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-14LNP_651614.1 UCR_14kD 12..105 CDD:460519 32/79 (41%)
AT5G25450NP_197927.1 UCR_14kD 4..109 CDD:460519 32/79 (41%)

Return to query results.
Submit another query.