DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-14L and AT4G32470

DIOPT Version :9

Sequence 1:NP_651614.1 Gene:UQCR-14L / 43369 FlyBaseID:FBgn0039576 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_194973.1 Gene:AT4G32470 / 829382 AraportID:AT4G32470 Length:122 Species:Arabidopsis thaliana


Alignment Length:80 Identity:33/80 - (41%)
Similarity:46/80 - (57%) Gaps:2/80 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 QYGLYRDDCL--YENEDVAEAVRRLPRKLYDERNYRILRALHLSMTKTILPKEQWTKYEEDIKYL 90
            :|||..||..  |.:.|:.||:.||||::.|.||.|:.||:.|||....|||:..........||
plant    30 RYGLRYDDLYDQYYSMDIKEAMNRLPREVVDARNQRLKRAMDLSMKHEYLPKDLQAVQTPFRGYL 94

  Fly    91 EPYLNEVQKEREERE 105
            :..|..|::|.:|||
plant    95 QDMLALVERESKERE 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-14LNP_651614.1 UCR_14kD 12..105 CDD:280439 31/78 (40%)
AT4G32470NP_194973.1 UCR_14kD 4..109 CDD:396723 31/78 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 59 1.000 Domainoid score I3891
eggNOG 1 0.900 - - E1_KOG3440
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I2554
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1606436at2759
OrthoFinder 1 1.000 - - FOG0003729
OrthoInspector 1 1.000 - - mtm1148
orthoMCL 1 0.900 - - OOG6_103572
Panther 1 1.100 - - O PTHR12022
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3089
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.