DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-14L and Uqcrb

DIOPT Version :9

Sequence 1:NP_651614.1 Gene:UQCR-14L / 43369 FlyBaseID:FBgn0039576 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_080495.1 Gene:Uqcrb / 67530 MGIID:1914780 Length:111 Species:Mus musculus


Alignment Length:92 Identity:61/92 - (66%)
Similarity:73/92 - (79%) Gaps:0/92 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KWAYNMSGFNQYGLYRDDCLYENEDVAEAVRRLPRKLYDERNYRILRALHLSMTKTILPKEQWTK 82
            ||.||.:|||:.||.|||.|:|.|||.||:||||..||::|.:||.|||.|:|...||||:||||
Mouse    19 KWYYNAAGFNKLGLMRDDTLHETEDVKEAIRRLPEDLYNDRMFRIKRALDLTMRHQILPKDQWTK 83

  Fly    83 YEEDIKYLEPYLNEVQKEREEREEWSK 109
            ||||..||||||.||.:||:|||||:|
Mouse    84 YEEDKFYLEPYLKEVIRERKEREEWAK 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-14LNP_651614.1 UCR_14kD 12..105 CDD:280439 56/86 (65%)
UqcrbNP_080495.1 UCR_14kD 9..106 CDD:396723 56/86 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850324
Domainoid 1 1.000 128 1.000 Domainoid score I5297
eggNOG 1 0.900 - - E1_KOG3440
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38164
Inparanoid 1 1.050 134 1.000 Inparanoid score I4561
Isobase 1 0.950 - 0 Normalized mean entropy S1136
OMA 1 1.010 - - QHG48987
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003729
OrthoInspector 1 1.000 - - otm42965
orthoMCL 1 0.900 - - OOG6_103572
Panther 1 1.100 - - O PTHR12022
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1049
SonicParanoid 1 1.000 - - X3089
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.