DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-14L and uqcrb

DIOPT Version :9

Sequence 1:NP_651614.1 Gene:UQCR-14L / 43369 FlyBaseID:FBgn0039576 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_001019613.1 Gene:uqcrb / 554154 ZFINID:ZDB-GENE-050522-542 Length:111 Species:Danio rerio


Alignment Length:92 Identity:58/92 - (63%)
Similarity:71/92 - (77%) Gaps:0/92 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KWAYNMSGFNQYGLYRDDCLYENEDVAEAVRRLPRKLYDERNYRILRALHLSMTKTILPKEQWTK 82
            ||.||..|||:.||.|||.:.|..||.|||||||..||:||.:|:.||:.|||...||||:||||
Zfish    19 KWYYNACGFNKLGLMRDDTIDEGSDVKEAVRRLPEPLYNERVFRLKRAMDLSMKHQILPKDQWTK 83

  Fly    83 YEEDIKYLEPYLNEVQKEREEREEWSK 109
            :|:|:|||||||.||.:||:|:|||.|
Zfish    84 FEQDVKYLEPYLQEVIRERKEKEEWDK 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-14LNP_651614.1 UCR_14kD 12..105 CDD:280439 54/86 (63%)
uqcrbNP_001019613.1 UCR_14kD 10..106 CDD:280439 54/86 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596241
Domainoid 1 1.000 124 1.000 Domainoid score I5465
eggNOG 1 0.900 - - E1_KOG3440
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38164
Inparanoid 1 1.050 131 1.000 Inparanoid score I4612
OMA 1 1.010 - - QHG48987
OrthoDB 1 1.010 - - D1606436at2759
OrthoFinder 1 1.000 - - FOG0003729
OrthoInspector 1 1.000 - - otm26457
orthoMCL 1 0.900 - - OOG6_103572
Panther 1 1.100 - - O PTHR12022
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1049
SonicParanoid 1 1.000 - - X3089
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.