DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-14L and UQCR-14

DIOPT Version :9

Sequence 1:NP_651614.1 Gene:UQCR-14L / 43369 FlyBaseID:FBgn0039576 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_573110.1 Gene:UQCR-14 / 32586 FlyBaseID:FBgn0030733 Length:111 Species:Drosophila melanogaster


Alignment Length:111 Identity:95/111 - (85%)
Similarity:102/111 - (91%) Gaps:0/111 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKYVARVGPAVFSKLGKWAYNMSGFNQYGLYRDDCLYENEDVAEAVRRLPRKLYDERNYRILRA 65
            ||.|:||.||||.|.||:||||:||||||||:|||||||||||.||||||||||||||||||:||
  Fly     1 MSNYIARKGPAVLSNLGRWAYNLSGFNQYGLHRDDCLYENEDVKEAVRRLPRKLYDERNYRIMRA 65

  Fly    66 LHLSMTKTILPKEQWTKYEEDIKYLEPYLNEVQKEREEREEWSKTH 111
            |||||||||||||||||||||:|||||||.||.|||||||:|.|.|
  Fly    66 LHLSMTKTILPKEQWTKYEEDVKYLEPYLKEVVKEREEREDWEKIH 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-14LNP_651614.1 UCR_14kD 12..105 CDD:280439 82/92 (89%)
UQCR-14NP_573110.1 UCR_14kD 12..94 CDD:396723 73/81 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471628
Domainoid 1 1.000 59 1.000 Domainoid score I3891
eggNOG 1 0.900 - - E1_KOG3440
Homologene 1 1.000 - - H38164
Inparanoid 1 1.050 59 1.000 Inparanoid score I2554
Isobase 1 0.950 - 0 Normalized mean entropy S1136
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1606436at2759
OrthoFinder 1 1.000 - - FOG0003729
OrthoInspector 1 1.000 - - otm26457
orthoMCL 1 0.900 - - OOG6_103572
Panther 1 1.100 - - P PTHR12022
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1049
SonicParanoid 1 1.000 - - X3089
1413.780

Return to query results.
Submit another query.