DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-14L and qcr7

DIOPT Version :9

Sequence 1:NP_651614.1 Gene:UQCR-14L / 43369 FlyBaseID:FBgn0039576 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_588364.1 Gene:qcr7 / 2539439 PomBaseID:SPCC737.02c Length:137 Species:Schizosaccharomyces pombe


Alignment Length:88 Identity:46/88 - (52%)
Similarity:59/88 - (67%) Gaps:2/88 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 AY-NMSGFNQYGLYRDD-CLYENEDVAEAVRRLPRKLYDERNYRILRALHLSMTKTILPKEQWTK 82
            || ::||:.:|||..|| .|.||:|..:|:.|||:....:|.|||.||:.||:...||||.:|||
pombe    26 AYVHLSGYRKYGLRYDDLMLEENDDTQKALSRLPKMESYDRVYRIRRAMQLSIENKILPKSEWTK 90

  Fly    83 YEEDIKYLEPYLNEVQKEREERE 105
            .|||..||.|.|.||..||:|||
pombe    91 PEEDYHYLRPVLAEVIAERKERE 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-14LNP_651614.1 UCR_14kD 12..105 CDD:280439 44/86 (51%)
qcr7NP_588364.1 UCR_14kD 16..113 CDD:280439 44/86 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 88 1.000 Domainoid score I2123
eggNOG 1 0.900 - - E1_KOG3440
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I1758
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003729
OrthoInspector 1 1.000 - - otm47163
orthoMCL 1 0.900 - - OOG6_103572
Panther 1 1.100 - - O PTHR12022
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1049
SonicParanoid 1 1.000 - - X3089
TreeFam 1 0.960 - -
1211.850

Return to query results.
Submit another query.