DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-14L and T02H6.11

DIOPT Version :9

Sequence 1:NP_651614.1 Gene:UQCR-14L / 43369 FlyBaseID:FBgn0039576 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_493795.1 Gene:T02H6.11 / 173459 WormBaseID:WBGene00020181 Length:130 Species:Caenorhabditis elegans


Alignment Length:102 Identity:38/102 - (37%)
Similarity:65/102 - (63%) Gaps:5/102 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VFSKLGKWAY-NMSGFNQYGLYRDDCLYE-NEDVAEAVRRLPRK---LYDERNYRILRALHLSMT 71
            :.|.|.|:|: |:.|..:|||...|..:| ..:|.||:|||..:   ::|:|..|:.||..|::.
 Worm    18 IASTLRKFAWSNLWGGREYGLQFHDTYFEPAPEVTEALRRLNLQEPHVFDQRKIRLSRAHTLALH 82

  Fly    72 KTILPKEQWTKYEEDIKYLEPYLNEVQKEREEREEWS 108
            ...|||.:||:::::..||:|||:|::.|::.|.|.|
 Worm    83 GEKLPKAEWTQWDQESWYLKPYLDEIEAEKKARAETS 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-14LNP_651614.1 UCR_14kD 12..105 CDD:280439 35/97 (36%)
T02H6.11NP_493795.1 UCR_14kD 19..116 CDD:280439 35/96 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167464
Domainoid 1 1.000 61 1.000 Domainoid score I6920
eggNOG 1 0.900 - - E1_KOG3440
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I3958
Isobase 1 0.950 - 0 Normalized mean entropy S1136
OMA 1 1.010 - - QHG48987
OrthoDB 1 1.010 - - D1606436at2759
OrthoFinder 1 1.000 - - FOG0003729
OrthoInspector 1 1.000 - - otm14778
orthoMCL 1 0.900 - - OOG6_103572
Panther 1 1.100 - - O PTHR12022
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1049
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.