DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mst98Cb and Y53C10A.10

DIOPT Version :10

Sequence 1:NP_524539.1 Gene:Mst98Cb / 43367 FlyBaseID:FBgn0004171 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001364573.1 Gene:Y53C10A.10 / 190195 WormBaseID:WBGene00013138 Length:359 Species:Caenorhabditis elegans


Alignment Length:33 Identity:9/33 - (27%)
Similarity:16/33 - (48%) Gaps:7/33 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PPFPK----CITVQQPPRMICKKR---VVFTEK 67
            ||..|    .:::..|.::..|:|   :||..|
 Worm   324 PPSGKFTIDLMSLPTPQKLSSKRRRAILVFKRK 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mst98CbNP_524539.1 None
Y53C10A.10NP_001364573.1 PHA03307 <80..>183 CDD:223039
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.