DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trv and NAM8

DIOPT Version :9

Sequence 1:NP_001163754.3 Gene:trv / 43362 FlyBaseID:FBgn0085391 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_011954.1 Gene:NAM8 / 856486 SGDID:S000001128 Length:523 Species:Saccharomyces cerevisiae


Alignment Length:306 Identity:73/306 - (23%)
Similarity:122/306 - (39%) Gaps:91/306 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 AVSAYQRNGKLPRNLPALRAMEMALRTNSFATPPAPHSLPLPPPHAARTEGGGQDMEDSDEEMEY 304
            |.:|..:||.|..|.|. :.:::...|:|::.  :.:||       ...:.|             
Yeast   119 AANALLKNGMLIPNFPN-KKLKLNWATSSYSN--SNNSL-------NNVKSG------------- 160

  Fly   305 MPPLHKQFHIFVGDLSSEIETQQLREAF-TPFGEISDCRVVRDPQTLKSKGYGFVSFIKKSEAES 368
                 ....||||||:..:...||.|.| ..:...|..::|.|..|..|||||||.|....|.:.
Yeast   161 -----NNCSIFVGDLAPNVTESQLFELFINRYASTSHAKIVHDQVTGMSKGYGFVKFTNSDEQQL 220

  Fly   369 AITAMNGQWLGSRSIRTNWATRKPPASKENIKPLTFDEVYNQSS--------------------- 412
            |::.|.|.:|..|:|:..      |.|.:. :.::.:..||:||                     
Yeast   221 ALSEMQGVFLNGRAIKVG------PTSGQQ-QHVSGNNDYNRSSSSLNNENVDSRFLSKGQSFLS 278

  Fly   413 -------------------------------PSNCTVYVGGVNSALTALSEEVLQKTFAPYGAIQ 446
                                           |:|.||::||::|.:|   |:.|:..|.|:|.|.
Yeast   279 NGNNNMGFKRNHMSQFIYPVQQQPSLNHFTDPNNTTVFIGGLSSLVT---EDELRAYFQPFGTIV 340

  Fly   447 EIRVFKDKGYAFVRFSTKEAATHAIVGVHNTEINAQPVKCSWGKES 492
            .:::...|...||::..:.:|..||.|:....|....|:.|||:.:
Yeast   341 YVKIPVGKCCGFVQYVDRLSAEAAIAGMQGFPIANSRVRLSWGRSA 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trvNP_001163754.3 RRM2_TIA1_like 313..387 CDD:240799 29/74 (39%)
RRM3_TIA1_like 416..491 CDD:240800 24/74 (32%)
NAM8NP_011954.1 RRM1_NGR1_NAM8_like 55..144 CDD:410023 7/25 (28%)
RRM2_SECp43_like 162..241 CDD:409781 30/84 (36%)
RRM3_NGR1_NAM8_like 312..383 CDD:409782 23/73 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.