DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trv and HRB1

DIOPT Version :9

Sequence 1:NP_001163754.3 Gene:trv / 43362 FlyBaseID:FBgn0085391 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_014394.2 Gene:HRB1 / 855728 SGDID:S000004949 Length:454 Species:Saccharomyces cerevisiae


Alignment Length:234 Identity:53/234 - (22%)
Similarity:81/234 - (34%) Gaps:42/234 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 PPPHAARTEGGGQDMEDSDEEMEYMPPLHKQFHIFVGDLSSEIETQQLREAFTPFGEISDCRVVR 345
            |||.....|....|.    .|:.:....|:   :.|.:|.:.:..|.|::.|...|.::...|..
Yeast   237 PPPSNNIKERKALDR----GELRHNRKTHE---VIVKNLPASVNWQALKDIFKECGNVAHADVEL 294

  Fly   346 DPQTLKSKGYGFVSFIKKSEAESAITAMNGQWLGSRSIRTNWATRKPPASKENIK---------- 400
            |...: |.|.|.|||....:...||...||.     ||..|....|   |||::.          
Yeast   295 DGDGV-STGSGTVSFYDIKDLHRAIEKYNGY-----SIEGNVLDVK---SKESVHNHSDGDDVDI 350

  Fly   401 PLTFDEVYNQSSPSNCTVYVGGVNSAL---------TALSEEVLQKTFAPYGAIQEIRVFKDK-- 454
            |:....|..::......|..||..:.|         ||.|:  |...|...|.:....:..|.  
Yeast   351 PMDDSPVNEEARKFTENVVGGGERNRLIYCSNLPFSTAKSD--LYDLFETIGKVNNAELRYDSKG 413

  Fly   455 ---GYAFVRFSTKEAATHAIVGVHNTEINAQPVKCSWGK 490
               |.|.|.:...:.|...|..::|.......:..|:.|
Yeast   414 APTGIAVVEYDNVDDADVCIERLNNYNYGGCDLDISYAK 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trvNP_001163754.3 RRM2_TIA1_like 313..387 CDD:240799 20/73 (27%)
RRM3_TIA1_like 416..491 CDD:240800 19/89 (21%)
HRB1NP_014394.2 PRK12678 <29..>85 CDD:237171
RRM1_HRB1_GBP2 160..236 CDD:410184
RRM2_HRB1_GBP2 262..334 CDD:410185 21/80 (26%)
RRM3_HRB1_GBP2 374..452 CDD:410186 15/79 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.