Sequence 1: | NP_001163754.3 | Gene: | trv / 43362 | FlyBaseID: | FBgn0085391 | Length: | 651 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_014382.1 | Gene: | PUB1 / 855716 | SGDID: | S000004961 | Length: | 453 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 265 | Identity: | 64/265 - (24%) |
---|---|---|---|
Similarity: | 100/265 - (37%) | Gaps: | 80/265 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 312 FHIFVGDLSSEIETQQLREAFTPFGEISDCRVVRDPQTLKSKGYGFVSFIKKSEAESAITAMNGQ 376
Fly 377 WLGSRSIRTNWATRK-------------------------------------------------- 391
Fly 392 -PPAS------------------------KENIKPLTFDEVYNQSSPSNCTVYVGGVNSALTALS 431
Fly 432 EEVLQKTFAPYGAIQEIRVFKDKGYAFVRFSTKEAATHAIVGVHNTEINAQPVKCSWGKESGD-- 494
Fly 495 PNNAQ 499 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
trv | NP_001163754.3 | RRM2_TIA1_like | 313..387 | CDD:240799 | 30/73 (41%) |
RRM3_TIA1_like | 416..491 | CDD:240800 | 20/74 (27%) | ||
PUB1 | NP_014382.1 | RRM1_PUB1 | 77..150 | CDD:410026 | |
RRM2_PUB1 | 161..240 | CDD:410031 | 34/77 (44%) | ||
RRM3_PUB1 | 341..414 | CDD:410033 | 21/75 (28%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 151 | 1.000 | Inparanoid score | I1117 |
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S1221 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000924 | |
OrthoInspector | 1 | 1.000 | - | - | otm46527 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
6 | 5.910 |