DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trv and PUB1

DIOPT Version :9

Sequence 1:NP_001163754.3 Gene:trv / 43362 FlyBaseID:FBgn0085391 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_014382.1 Gene:PUB1 / 855716 SGDID:S000004961 Length:453 Species:Saccharomyces cerevisiae


Alignment Length:265 Identity:64/265 - (24%)
Similarity:100/265 - (37%) Gaps:80/265 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 FHIFVGDLSSEIETQQLREAFTPFGEISDCRVVRDPQTLKSKGYGFVSFIKKSEAESAITAMNGQ 376
            |::|||||:..::.:.||.||..|.......|:.|.||..|:|||||||..:.:|::|:.:|.||
Yeast   162 FNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQ 226

  Fly   377 WLGSRSIRTNWATRK-------------------------------------------------- 391
            .|..|.:|.|||.::                                                  
Yeast   227 DLNGRPLRINWAAKRDNNNNNNYQQRRNYGNNNRGGFRQYNSNNNNNMNMGMNMNMNMNMNNSRG 291

  Fly   392 -PPAS------------------------KENIKPLTFDEVYNQSSPSNCTVYVGGVNSALTALS 431
             ||:|                        ...:.|...|.:...:.|...|.|:|.:....|   
Yeast   292 MPPSSMGMPIGAMPLPSQGQPQQSQTIGLPPQVNPQAVDHIIRSAPPRVTTAYIGNIPHFAT--- 353

  Fly   432 EEVLQKTFAPYGAIQEIRVFKDKGYAFVRFSTKEAATHAIVGVHNTEINAQPVKCSWGKESGD-- 494
            |..|...|..:|.|.:.:.:.:||..|:::.|.|.|...||.:.|.....:.::..||||..:  
Yeast   354 EADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERSNFM 418

  Fly   495 PNNAQ 499
            |...|
Yeast   419 PQQQQ 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trvNP_001163754.3 RRM2_TIA1_like 313..387 CDD:240799 30/73 (41%)
RRM3_TIA1_like 416..491 CDD:240800 20/74 (27%)
PUB1NP_014382.1 RRM1_PUB1 77..150 CDD:410026
RRM2_PUB1 161..240 CDD:410031 34/77 (44%)
RRM3_PUB1 341..414 CDD:410033 21/75 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 151 1.000 Inparanoid score I1117
Isobase 1 0.950 - 0 Normalized mean entropy S1221
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000924
OrthoInspector 1 1.000 - - otm46527
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.