DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trv and AT3G09160

DIOPT Version :9

Sequence 1:NP_001163754.3 Gene:trv / 43362 FlyBaseID:FBgn0085391 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_187528.2 Gene:AT3G09160 / 820071 AraportID:AT3G09160 Length:132 Species:Arabidopsis thaliana


Alignment Length:119 Identity:29/119 - (24%)
Similarity:49/119 - (41%) Gaps:30/119 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 DLSSEIETQQLREAFTPFGEISDCRVVRDPQTLKSK--GYGFVSFIKKSEAESAITAMNGQWLGS 380
            :|..|....:|::.|:|.|||:|..:   |:|..|.  .:.|:.|:.:..|:.|: .:||..:| 
plant    33 ELPREHVESELKKLFSPCGEITDVHI---PETRNSSLWSHAFIYFVGEGTADKAL-QLNGSDMG- 92

  Fly   381 RSIRTNWA--TRKPPASKENIKPLTFDEVYNQSSPSNCT-VYVGGVNSALTALS 431
                 .|.  ....|..||.               .||. :.|.|.::.|..:|
plant    93 -----G
WTVDAEADPFPKEE---------------DNCVELEVEGYDTTLRLVS 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trvNP_001163754.3 RRM2_TIA1_like 313..387 CDD:240799 19/70 (27%)
RRM3_TIA1_like 416..491 CDD:240800 5/17 (29%)
AT3G09160NP_187528.2 RRM_SF 25..93 CDD:302621 19/69 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1066369at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.