DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trv and Rbm31y

DIOPT Version :9

Sequence 1:NP_001163754.3 Gene:trv / 43362 FlyBaseID:FBgn0085391 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_083246.1 Gene:Rbm31y / 74484 MGIID:1921734 Length:565 Species:Mus musculus


Alignment Length:406 Identity:87/406 - (21%)
Similarity:140/406 - (34%) Gaps:129/406 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   314 IFVGDLSSEIETQQLREAFTPFGEISDCRVVRDPQTLKSKGYGFVSFIKKSEAESAITAMNGQWL 378
            :|:|.||.|:..|.|.|..:.||||.|..:..||.|..|:|:|||.|...:..|..:...:    
Mouse    35 MFIGGLSQEMSKQVLLEYLSKFGEIIDFIIKTDPNTGLSRGFGFVLFKDSATVEKVLQVKD---- 95

  Fly   379 GSRSIRTNWATRKPPASKENIKPLTFDEVYN-QSSPSNCTVYVGGVNSALTALSEEVLQKTFAPY 442
                            .|.:.|.:.|..... :|...|..::|||:|   ..||||.::..|..:
Mouse    96 ----------------HKVDGKKIEFKRAKALESQFPNKKIFVGGLN---PRLSEEKIRAYFGTF 141

  Fly   443 GAIQ--EIRVFKD----KGYAFVRFSTKEAATHAI------VGVHNTEINAQPVKCSWGKESGDP 495
            |.|:  |:.:..|    :.:.|:::..:.:....:      :|....|     ||.::.||  :|
Mouse   142 GQIEAIELPLCSDTRERRAFGFIKYMDENSVRKVLENRYHFIGSSRCE-----VKMAYPKE--NP 199

  Fly   496 ----NNAQTIATQALNSAAAA--------AAGFP-YGVGAAAAAAAYGQQLAATG---------- 537
                :..:.||......:..|        ..|.| :.:.|.:.|....|.....|          
Mouse   200 ARQLSKRKAIAKDRTRKSVPAVELENNWRGGGSPSFHIMANSEAQEANQDAHRAGSYTSRANSDV 264

  Fly   538 -----CWYSPTP--------TYPASSATAAAVTPAAASAA-----------AVQNQFLQGIQGYH 578
                 |.:..:|        .:..:|.|..|.:.|..|:.           |..|.||  ...|.
Mouse   265 TLTNACGFRDSPNAFHVNSNVFVTNSTTFIASSNALRSSTNTVGVSHYTLDANPNTFL--ASQYT 327

  Fly   579 FG---------QY--GGYQQGYMGMGVQIPATWQGVTQAQISPAQQLATGVAGTAIPQAAGVVAY 632
            .|         ||  |.|....            ||:|..::            |.|...|:..|
Mouse   328 LGTISNTLRTSQYTLGTYPNAL------------GVSQYALA------------AYPNTFGINQY 368

  Fly   633 PIQQFQVS--PQVYPL 646
            |::..|.:  ...|||
Mouse   369 PLEADQNAFWTNQYPL 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trvNP_001163754.3 RRM2_TIA1_like 313..387 CDD:240799 23/72 (32%)
RRM3_TIA1_like 416..491 CDD:240800 18/86 (21%)
Rbm31yNP_083246.1 RRM_SF 35..108 CDD:302621 26/92 (28%)
RRM_SF 119..193 CDD:302621 18/81 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.