DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trv and Trnau1ap

DIOPT Version :9

Sequence 1:NP_001163754.3 Gene:trv / 43362 FlyBaseID:FBgn0085391 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_082201.2 Gene:Trnau1ap / 71787 MGIID:1919037 Length:287 Species:Mus musculus


Alignment Length:193 Identity:56/193 - (29%)
Similarity:83/193 - (43%) Gaps:48/193 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 LPGTYRVQSLKSAAAAAVSAYQRNGK-LPRNLPALRAMEMALRTNSFATPPAPHSLPLPPPHAAR 287
            :|..|........|.|....::.||| ||...||.|     .:.| :||                
Mouse    43 IPAGYCFVEFADLATAEKCLHKINGKPLPGATPAKR-----FKLN-YAT---------------- 85

  Fly   288 TEGGGQDMEDSDEEMEYMPPLHKQFHIFVGDLSSEIETQQLREAFTPFGEISDCR---VVRDPQT 349
               .|:..::|.|           :.:|||||:.:::...|.|.|...  ...||   ||.|| |
Mouse    86 ---YGKQPDNSPE-----------YSLFVGDLTPDVDDGMLYEFFVKV--YPSCRGGKVVLDP-T 133

  Fly   350 LKSKGYGFVSFIKKSEAESAITAMNGQ-WLGSRSIRTNWATRKPPASKENIKPLTFDEVYNQS 411
            ..|||||||.|..:.|.:.|:|...|. .||.:.:|.:.|.  |.||:  :||:.:.::|:.|
Mouse   134 GVSKGYGFVKFTDELEQKRALTECQGAVGLGCKPVRLSVAI--PKASR--VKPVEYSQMYSYS 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trvNP_001163754.3 RRM2_TIA1_like 313..387 CDD:240799 30/77 (39%)
RRM3_TIA1_like 416..491 CDD:240800
Trnau1apNP_082201.2 RRM1_SECp43 4..87 CDD:241054 15/68 (22%)
RRM2_SECp43 95..176 CDD:241056 32/96 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.