DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trv and hnrnpd

DIOPT Version :9

Sequence 1:NP_001163754.3 Gene:trv / 43362 FlyBaseID:FBgn0085391 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_001025523.1 Gene:hnrnpd / 594903 XenbaseID:XB-GENE-988375 Length:295 Species:Xenopus tropicalis


Alignment Length:325 Identity:76/325 - (23%)
Similarity:127/325 - (39%) Gaps:81/325 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   286 ARTEGGGQ------DMEDSDEEMEYMPPLHKQFHIFVGDLSSEIETQQLREAFTPFGEISDCRVV 344
            |.||..||      |...::|:         :..:|:|.||.:...:.|::.|:.|||:.||.:.
 Frog    15 AETEETGQNEGVKIDASKTEED---------EGKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLK 70

  Fly   345 RDPQTLKSKGYGFVSFIKKSEAESAITAMNGQWLGSRSIRTNWATRKPPASKENIKPLTFDEVYN 409
            .||.|.:|:|:|||.| |:||....:.......|..:.|....|  |...:||.:|         
 Frog    71 LDPITGRSRGFGFVLF-KESEGVDKVMEQKEHKLNGKVIDPKRA--KAMKTKEPVK--------- 123

  Fly   410 QSSPSNCTVYVGGVNSALTALSEEVLQKTFAPYGAIQEI------RVFKDKGYAFVRFSTKEAAT 468
                   .::|||::   ....||.:::.|..:|.|:.|      :..|.:|:.|:.|..::...
 Frog   124 -------KIFVGGLS---PDTPEEKIREYFGTFGEIEAIELPMDNKTNKRRGFCFITFKEEDPVK 178

  Fly   469 HAI-VGVHNTEINAQPVKCSWGKESGDPNNAQTIATQALNSAAAAAAGFPYGVGAAAAAAAYGQQ 532
            ..: ...||..::...:|.:..||       |....|...:....::..|.|.|..:...:.|. 
 Frog   179 KIMEKKYHNVGLSKCEIKVALSKE-------QYQQQQQWGTRGGGSSSRPRGRGGVSQTWSQGY- 235

  Fly   533 LAATGCWYSPTPTYPASSATAAAVTPAAASAAAVQNQFLQG-----IQGYHFGQYGGY---QQGY 589
               :..|   .|:|               |:....||...|     ..||::..||.|   |.||
 Frog   236 ---SNYW---NPSY---------------SSYGYNNQGYGGYGNYDYSGYNYYGYGDYSNQQSGY 279

  Fly   590  589
             Frog   280  279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trvNP_001163754.3 RRM2_TIA1_like 313..387 CDD:240799 25/73 (34%)
RRM3_TIA1_like 416..491 CDD:240800 16/81 (20%)
hnrnpdNP_001025523.1 RRM1_hnRNPD 40..113 CDD:241200 25/73 (34%)
RRM2_hnRNPD 124..198 CDD:241027 16/76 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.