DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trv and hnrnpd

DIOPT Version :9

Sequence 1:NP_001163754.3 Gene:trv / 43362 FlyBaseID:FBgn0085391 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_001103930.1 Gene:hnrnpd / 560522 ZFINID:ZDB-GENE-070424-97 Length:314 Species:Danio rerio


Alignment Length:322 Identity:73/322 - (22%)
Similarity:116/322 - (36%) Gaps:103/322 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 EGGGQDMEDSDEEMEYMPPLHKQFHIFVGDLSSEIETQQLREAFTPFGEISDCRVVRDPQTLKSK 353
            ||...|...::|:         :..:|||.||.:...:.|::.||.|||:.||.:..||.|.:|:
Zfish    40 EGSKIDASKNEED---------EGKMFVGGLSWDTTKKDLKDYFTKFGEVVDCTLKLDPLTGRSR 95

  Fly   354 GYGFVSFIKKSEAESAIT----AMNGQWLGSRSIRTNWATRKPPASKENIKPLTFDEVYNQSSPS 414
            |:|||.|.:....|..||    .:||:.:..:.       .|...:||.:|              
Zfish    96 GFGFVLFKEAESVEKVITQKEHKLNGKVIDPKK-------AKAMKTKEPVK-------------- 139

  Fly   415 NCTVYVGGVNSALTALSEEVLQKTFAPYGAIQEI------RVFKDKGYAFVRFSTKEAATHAIVG 473
              .::|||::   ....||.:::.|..||.::.|      :..|.:|:.|:.|..:|.....:..
Zfish   140 --KIFVGGLS---PDTPEEKIREYFDAYGEVESIELPMENKTNKRRGFCFITFKEEEPVKKIMEK 199

  Fly   474 V-HNTEINAQPVKCSWGKESGDPNNAQTIATQALNSAAAAAAGFPYGVGAAAAAAAYGQQLAATG 537
            : ||..::...||.:..||.                                    |.||....|
Zfish   200 MYHNIGLSKCEVKVAMSKEQ------------------------------------YQQQQQWGG 228

  Fly   538 CWYSPTPTYPASSATAAAVTPAAASAAAVQNQFLQGI-----QGY-HFGQYGGYQQGYMGMG 593
                           ....|............:.||.     ||| ::|.||...|||.|.|
Zfish   229 ---------------RGGYTSRGRGRGGPNQNWNQGYGNYWNQGYGNYGNYGYNNQGYGGYG 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trvNP_001163754.3 RRM2_TIA1_like 313..387 CDD:240799 27/77 (35%)
RRM3_TIA1_like 416..491 CDD:240800 18/81 (22%)
hnrnpdNP_001103930.1 CBFNT 3..54 CDD:285369 4/22 (18%)
RRM1_hnRNPD_like 56..129 CDD:241019 27/79 (34%)
RRM2_hnRNPD 140..214 CDD:241027 18/76 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.