DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trv and hnrnpa2b1

DIOPT Version :9

Sequence 1:NP_001163754.3 Gene:trv / 43362 FlyBaseID:FBgn0085391 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_001192271.1 Gene:hnrnpa2b1 / 549680 XenbaseID:XB-GENE-490993 Length:350 Species:Xenopus tropicalis


Alignment Length:301 Identity:73/301 - (24%)
Similarity:116/301 - (38%) Gaps:88/301 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   310 KQFH-IFVGDLSSEIETQQLREAFTPFGEISDCRVVRDPQTLKSKGYGFVSFIKKSEAESAITAM 373
            :||. :|:|.||.|.....||..:..:|:::||.|:|||.:.:|:|:|||:|....|.::::.| 
 Frog     6 EQFRKLFIGGLSFETTEDSLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMDEVDASMAA- 69

  Fly   374 NGQWLGSRSIRTNWATRKPPASKENIKPLTFDEVYNQSSPSNCTV---YVGGVNSALTALSEEVL 435
            ....:..|.:.    .::..|.:|:.||           .::.||   :|||:..   ...|..|
 Frog    70 RPHTIDGRVVE----PKRAVAREESAKP-----------GAHVTVKKLFVGGIKE---DTEEHHL 116

  Fly   436 QKTFAPYGAIQEIRVFKDK------GYAFVRFSTKEAAT-------HAIVGVHNTEINAQPVKCS 487
            ::.|..||.|:.|.:..||      |:.||.|...:...       |.|.| ||.|:.    |..
 Frog   117 REYFEEYGKIESIEIITDKQSGKKRGFGFVTFDDHDPVDKIVLQKYHTING-HNAEVR----KAL 176

  Fly   488 WGKESGDPNNAQTIATQALNSAAAAAAGFPYGVGAAAAAAAYGQQLAATGCWYSPTPTYPASSAT 552
            ..:|..|..|.:.            :.|..:|.|.:.....:|.         .|...:..||  
 Frog   177 SKQEMQDVQNTRN------------SRGGNFGFGDSRGGGNFGS---------GPGGNFRGSS-- 218

  Fly   553 AAAVTPAAASAAAVQNQFLQGIQGYHFGQYGGYQQGYMGMG 593
                                  .||..|:  ||..||.|.|
 Frog   219 ----------------------DGYGGGR--GYGDGYNGYG 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trvNP_001163754.3 RRM2_TIA1_like 313..387 CDD:240799 23/74 (31%)
RRM3_TIA1_like 416..491 CDD:240800 25/90 (28%)
hnrnpa2b1NP_001192271.1 RRM1_hnRNPA2B1 7..87 CDD:241206 25/84 (30%)
RRM2_hnRNPA2B1 100..179 CDD:241025 23/86 (27%)
HnRNPA1 294..319 CDD:288479
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.