DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trv and Boll

DIOPT Version :9

Sequence 1:NP_001163754.3 Gene:trv / 43362 FlyBaseID:FBgn0085391 Length:651 Species:Drosophila melanogaster
Sequence 2:XP_006245003.1 Gene:Boll / 501143 RGDID:1559527 Length:340 Species:Rattus norvegicus


Alignment Length:304 Identity:75/304 - (24%)
Similarity:117/304 - (38%) Gaps:72/304 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   365 EAESAITAMNGQWLGSRSIRTNWATRKPPASKENIKPLTFDEVYNQSSPSNCTVYVGGVNSALTA 429
            |.||.....|.....|.|...|      |.|...:...|....|....|:.  ::|||::   ..
  Rat     2 ETESRAQTTNQTQTDSLSPSPN------PVSPVPLNNPTSGPRYGTVIPNR--IFVGGID---FK 55

  Fly   430 LSEEVLQKTFAPYGAIQEIRVFKD-----KGYAFVRFSTKEAATHAIVGVHNTEINAQPVKCSWG 489
            .:|..|:|.|:.||:::|:::..|     |||.|:.|.|:|.|...:....  ::|.:..|.:.|
  Rat    56 TNENDLRKFFSQYGSVKEVKIVNDRAGVSKGYGFITFETQEDAQKILQEAE--KLNYKDKKLNIG 118

  Fly   490 -----KESGDPNNAQTIATQALNSAAAAAAGFPY----GVGAAAAAAAYGQQLAATGCWYSPTPT 545
                 ::.|.|.:  :|...|.......:.|:||    ||       ||......|    |..|:
  Rat   119 PAIRKQQVGIPRS--SIMPAAGTMYLTTSTGYPYTYHNGV-------AYFHTPEVT----SVPPS 170

  Fly   546 YPASSATAAAVTPAAASAAAVQNQFLQGIQGYHFGQYGGYQQGYMGMGVQIPATWQ-GVTQAQIS 609
            :|:.|.:::.|..|       |..:.|  ..||          |......||..|| ||.|:..|
  Rat   171 WPSRSISSSPVMVA-------QPVYQQ--PAYH----------YQAPAQCIPGQWQWGVPQSPAS 216

  Fly   610 --------PAQQLATGVAGTAIPQAAGVVAYPIQQFQVS-PQVY 644
                    |::.:...|   .|.|..|.|..|:...:.| |:.|
  Rat   217 SAPFLYLQPSEVIYQPV---EIAQDGGCVPPPLSLMEASVPEPY 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trvNP_001163754.3 RRM2_TIA1_like 313..387 CDD:240799 6/21 (29%)
RRM3_TIA1_like 416..491 CDD:240800 22/84 (26%)
BollXP_006245003.1 RRM_BOULE 43..123 CDD:410074 23/86 (27%)
PABP-1234 <45..293 CDD:130689 63/255 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.