DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trv and hnrnpa1

DIOPT Version :9

Sequence 1:NP_001163754.3 Gene:trv / 43362 FlyBaseID:FBgn0085391 Length:651 Species:Drosophila melanogaster
Sequence 2:XP_012812298.1 Gene:hnrnpa1 / 496507 XenbaseID:XB-GENE-493963 Length:362 Species:Xenopus tropicalis


Alignment Length:308 Identity:74/308 - (24%)
Similarity:118/308 - (38%) Gaps:61/308 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   314 IFVGDLSSEIETQQLREAFTPFGEISDCRVVRDPQTLKSKGYGFVSFIKKSEAESAITAMNGQWL 378
            :|:|.||.|...:.|||.|..:|.::||.|:|||.:.:|:|:|||::....|.::|::|...: :
 Frog    16 LFIGGLSFETTDESLREHFEQWGTLTDCVVMRDPNSKRSRGFGFVTYSSTDEVDAAMSARPHK-V 79

  Fly   379 GSRSIRTNWATRKPPASKENIKPLTFDEVYNQSSPSNCTVYVGGVNSALTALSEEVLQKTFAPYG 443
            ..|.:....|..:..:|:.... ||..:           ::|||:..   ...|..|::.|..||
 Frog    80 DGRVVEPKRAVSR
EDSSRPGAH-LTVKK-----------IFVGGIKE---DTEEHHLREYFEQYG 129

  Fly   444 AIQEIRVFKD------KGYAFVRFSTKEAATHAI------VGVHNTEI----NAQPVKCSWGKES 492
            .|:.|.:..|      :|:|||.|...::....:      |..||.|:    :.|.:....|.:.
 Frog   130 KIEVIEIMTDRGSGKKRGFAFVTFEDHDSVDKIVIQKYHTVNNHNCEVRKALSKQEMASVSGSQR 194

  Fly   493 GDPNNAQTIATQALNSAAAAAAG--FPYGVGAAAAAAAYG----QQLAATGCWYSPTPTYPASSA 551
            |...:..........:......|  |....|.......||    ......| .|..:|.|...:.
 Frog   195 GRGGSGNFSGRGGFGNDNFGGRGGNFSSNRGGGFGNRGYGGDGYNGFGNDG-GYGGSPPYSGGNR 258

  Fly   552 TAAAVTPAAASAAAVQNQFLQGIQGYHFGQYGGY------QQGYMGMG 593
            ....                .|.|||..||.|||      ..||.|.|
 Frog   259 GYGG----------------GGGQGYGGGQGGGYGGGNGGYDGYNGGG 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trvNP_001163754.3 RRM2_TIA1_like 313..387 CDD:240799 25/72 (35%)
RRM3_TIA1_like 416..491 CDD:240800 22/90 (24%)
hnrnpa1XP_012812298.1 RRM1_hnRNPA1 12..92 CDD:241205 26/76 (34%)
RRM2_hnRNPA1 105..181 CDD:241024 20/89 (22%)
HnRNPA1 <315..>334 CDD:371635
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.