DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trv and hnrnpdl

DIOPT Version :9

Sequence 1:NP_001163754.3 Gene:trv / 43362 FlyBaseID:FBgn0085391 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_001011015.1 Gene:hnrnpdl / 496424 XenbaseID:XB-GENE-495016 Length:297 Species:Xenopus tropicalis


Alignment Length:291 Identity:70/291 - (24%)
Similarity:113/291 - (38%) Gaps:62/291 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   314 IFVGDLSSEIETQQLREAFTPFGEISDCRVVRDPQTLKSKGYGFVSFIKKSEAESAITAMNGQWL 378
            :|:|.||.:...:.|.|..:.|||:.||.:..||.|.:|:|:|||.|      :.|:        
 Frog    28 MFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLF------KDAV-------- 78

  Fly   379 GSRSIRTNWATRKPPASKENIKPLTFDEVYNQSSPSNCTVYVGGVNSALTALSEEVLQKTFAPYG 443
               |:.....|::.....:.|.|.....:..:..|..  |:|||::...|   ||.:::.|..:|
 Frog    79 ---SVDKVLETKEHKLDGKLIDPKRAK
ALKGKEPPKK--VFVGGLSPETT---EEQIKQYFGGFG 135

  Fly   444 AIQEIRVFKD------KGYAFVRFSTKEAATHAI------VGVHNTEIN-AQPVKCSWGKESGDP 495
            .|:.|.:..|      :|:.||.::.:|.....:      :|....||. |||.:....::....
 Frog   136 EIENIELPMDTKTNERRGFCFVTYTGEEPVKKLLESRFHQIGTGKCEIKVAQPKEVYRQQQQKQQ 200

  Fly   496 NNAQTIATQALNSAAAAAAGFPYGVGAAAAAAAYGQQLAATGCWYSPTPTYPASSATAAAVTPAA 560
            ...:..||     ....|.|...|.|.....:.|..|...:   |....:|              
 Frog   201 KGGRGAAT-----GRGGARGRGRGQGWNQGYSNYYDQNYGS---YGNNGSY-------------- 243

  Fly   561 ASAAAVQNQFLQG--IQGYHFGQYGGYQQGY 589
              |....|....|  ..||::|.| ||.|||
 Frog   244 --ADQGYNNSYSGYDYSGYNYGSY-GYNQGY 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trvNP_001163754.3 RRM2_TIA1_like 313..387 CDD:240799 22/72 (31%)
RRM3_TIA1_like 416..491 CDD:240800 22/87 (25%)
hnrnpdlNP_001011015.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
RRM1_hnRPDL 27..102 CDD:410152 25/90 (28%)
RRM2_hnRPDL 112..186 CDD:409998 19/78 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 192..224 6/36 (17%)
Trnau1ap 222..>278 CDD:407550 16/70 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.