DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trv and tra2b

DIOPT Version :9

Sequence 1:NP_001163754.3 Gene:trv / 43362 FlyBaseID:FBgn0085391 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_001006878.1 Gene:tra2b / 448667 XenbaseID:XB-GENE-5864557 Length:293 Species:Xenopus tropicalis


Alignment Length:138 Identity:37/138 - (26%)
Similarity:58/138 - (42%) Gaps:36/138 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 LSSEIETQQLREAFTPFGEISDCRVVRDPQTLKSKGYGFVSFIKKSEAESAITAMNGQWLGSRSI 383
            ||.....:.|||.|:.:|.|||..:|.|.|:.:|:|:.||.|....:|:.|....||..|..|.|
 Frog   129 LSLYTTERDLREVFSKYGPISDVSIVYDQQSRRSRGFSFVYFENVDDAKEAKERANGMELDGRRI 193

  Fly   384 RTNWATRKPPASKENIKPLTFDEVYNQSSPSNCTVYVGGVNSALTALSEEVLQKTFAPYGAIQEI 448
            |.:::..|.|               :..:|.   :|:|.                 ..||:.:. 
 Frog   194 RVDFSITK
RP---------------HTPTPG---IYMGR-----------------PTYGSSRR- 222

  Fly   449 RVFKDKGY 456
            |.:.|:||
 Frog   223 RDYYDRGY 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trvNP_001163754.3 RRM2_TIA1_like 313..387 CDD:240799 26/67 (39%)
RRM3_TIA1_like 416..491 CDD:240800 8/41 (20%)
tra2bNP_001006878.1 RRM_SF 113..201 CDD:388407 26/71 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.