DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trv and tra2a

DIOPT Version :9

Sequence 1:NP_001163754.3 Gene:trv / 43362 FlyBaseID:FBgn0085391 Length:651 Species:Drosophila melanogaster
Sequence 2:XP_012819962.1 Gene:tra2a / 448073 XenbaseID:XB-GENE-492325 Length:341 Species:Xenopus tropicalis


Alignment Length:197 Identity:46/197 - (23%)
Similarity:78/197 - (39%) Gaps:33/197 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 SRTPATPPLPGTYRVQS-LKSAAAAAVSAYQRNGKLPRNLPALRAME--------MALRTNSFAT 271
            ||:.:..|.....||:| .:|.:.:|..|.:|:....|:....|:..        ...|:.|.:.
 Frog     9 SRSRSKSPAESAPRVKSESRSRSRSASRASKRSESRSRSRSKSRSRSRRHSHRRYSRSRSRSHSR 73

  Fly   272 PPAPHSLPLPPPHAARTEGGGQDMEDSDEEMEYMPPLHKQFH------------IFVGDLSSEIE 324
            .....|....|.:..|            ....:.|..:::.|            |.|..||....
 Frog    74 KRRSKSRSYTPEYRRR------------RSRSHSPMSNRRRHNGSRANPDPNICIGVFGLSLYTT 126

  Fly   325 TQQLREAFTPFGEISDCRVVRDPQTLKSKGYGFVSFIKKSEAESAITAMNGQWLGSRSIRTNWAT 389
            .:.|||.|:.:|.:|...||.|.:|.:|:|:.||.|.:..::..|:...||..|..|.||.:::.
 Frog   127 ERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIEDSREAMEHANGMELDGRRIRVDYSI 191

  Fly   390 RK 391
            .|
 Frog   192 TK 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trvNP_001163754.3 RRM2_TIA1_like 313..387 CDD:240799 27/85 (32%)
RRM3_TIA1_like 416..491 CDD:240800
tra2aXP_012819962.1 RRM <98..>190 CDD:223796 27/91 (30%)
RRM_TRA2 115..192 CDD:240809 26/76 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.