DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trv and Rb97D

DIOPT Version :9

Sequence 1:NP_001163754.3 Gene:trv / 43362 FlyBaseID:FBgn0085391 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_001014671.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster


Alignment Length:413 Identity:86/413 - (20%)
Similarity:133/413 - (32%) Gaps:130/413 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 DMEDSDE-EMEYMPPLHKQFHIFVGDLSSEIETQQLREAFTPFGEISDCRVVRDPQTLKSKGYGF 357
            |.|:.|. |:|::..|      |:|.|:.....:.|:..:..:|::.|..|:||..|.:|:|:||
  Fly    19 DREEDDICELEHLRKL------FIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGF 77

  Fly   358 VSFIKKSEAESAITAMNGQWLGSRSIRTNWATRKPPASKENIKPLTFDEVYNQSSPSNCTV---Y 419
            :::.|....:.| .......:..:::....|..:|.               .:|..:|.:|   :
  Fly    78 ITYTKSLMVDRA-QENRPHIIDGKTVEAKRALPRPE---------------RESRETNISVKKLF 126

  Fly   420 VGGVNSALTALSEEVLQKTFAPYGAIQEIRVFKDK------GYAFVRFSTKEAA-------THAI 471
            |||:..   ...||.|::.|..:|.:..:::..||      |:|||.|...:|.       .|||
  Fly   127 VGGLKD---NHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQHAI 188

  Fly   472 VGVHNTEINAQPVKCSW----GKESGDPNNAQTIATQALNSAAAAAAG-------------FPYG 519
            ..||      ..||.|.    .||...|.........:||.......|             |...
  Fly   189 KYVH------VDVKKSIYNLDKKEKQQPGGLANAIKPSLNQQQQQQGGGQQPPNGNMQAPSFRPP 247

  Fly   520 VGAAAAAAAYGQQ-----LAAT----GCWYSPTPT------------------YPASSATAAAVT 557
            |....|...|.||     ::|.    ..|..|.|.                  ||..........
  Fly   248 VPPQQAMGPYQQQPPPAPMSAPPPNFNYWGPPPPAMPPYYQQPPPQQMNGWGPYPPPQQNGWNAP 312

  Fly   558 PAAASAAAVQNQFLQGIQGYHFGQYG---GYQQ-----------GYMGMGVQIPATW-------- 600
            |...          .|.|.:|..|:|   ..||           |:.|.....|..|        
  Fly   313 PPPP----------PGAQQWHANQWGCPPPVQQVPPVGAVPPPMGHNGPPPTAPGNWNMPPPVPG 367

  Fly   601 ------QGVTQAQISPAQQLATG 617
                  |..:..|.:|.....||
  Fly   368 AAPPSHQQQSSQQPTPQPNFGTG 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trvNP_001163754.3 RRM2_TIA1_like 313..387 CDD:240799 16/73 (22%)
RRM3_TIA1_like 416..491 CDD:240800 25/94 (27%)
Rb97DNP_001014671.1 RRM1_hnRNPA_like 33..110 CDD:241022 18/83 (22%)
RRM2_hnRNPA_like 124..196 CDD:240774 21/80 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.