DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trv and CstF64

DIOPT Version :9

Sequence 1:NP_001163754.3 Gene:trv / 43362 FlyBaseID:FBgn0085391 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster


Alignment Length:98 Identity:30/98 - (30%)
Similarity:52/98 - (53%) Gaps:3/98 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 MEDSDEEMEYMPPLHKQFHIFVGDLSSEIETQQLREAFTPFGEISDCRVVRDPQTLKSKGYGFVS 359
            |.|..:|...|....:.  :|||::..|...::|:|.|:..|.:...::|.|.::.|.||:||..
  Fly     1 MADKAQEQSIMDKSMRS--VFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCE 63

  Fly   360 FIKKSEAESAITAMNGQWLGSRSIRT-NWATRK 391
            :..:..|.||:..:||..:|.|::|. |..|.|
  Fly    64 YKDQETALSAMRNLNGYEIGGRTLRVDNACTEK 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trvNP_001163754.3 RRM2_TIA1_like 313..387 CDD:240799 23/74 (31%)
RRM3_TIA1_like 416..491 CDD:240800
CstF64NP_477453.1 RRM <13..>112 CDD:223796 26/86 (30%)
RRM_CSTF2_CSTF2T 18..92 CDD:241115 23/73 (32%)
CSTF2_hinge 112..190 CDD:291025
CSTF_C 377..416 CDD:291002
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.