DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trv and nonA-l

DIOPT Version :9

Sequence 1:NP_001163754.3 Gene:trv / 43362 FlyBaseID:FBgn0085391 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_001262646.1 Gene:nonA-l / 42026 FlyBaseID:FBgn0015520 Length:630 Species:Drosophila melanogaster


Alignment Length:201 Identity:48/201 - (23%)
Similarity:79/201 - (39%) Gaps:56/201 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   290 GGGQDMED---SDEEMEYMPPLHK--------------QFHIFVGDLSSEIETQQLREAFTPFGE 337
            ||||..||   :...::...|.|:              :..::||:|:|:.....|||.|.|:||
  Fly   226 GGGQRGEDFFIAQRLLDISGPTHELPPIELPTDNKFVGRNRLYVGNLTSDTTDDDLREMFKPYGE 290

  Fly   338 ISDCRVVRDPQTLKSKGYGFVSFIKKSEAESAITAMNGQWLGSRSIRTNWATRKPPASKENIKPL 402
            |.|  :..:|:    |.:.|:.......||.|..|::|.....|.:|..:|              
  Fly   291 IGD--IFSNPE----KNFTFLRLDYYQNAEKAKRALDGSLRKGRVLRVRFA-------------- 335

  Fly   403 TFDEVYNQSSPSNCTVYVGGVNSALTALSEEVLQKTFAPYGAIQEIRVF-----KDKGYAFVRFS 462
                       .|..|.|..:|.   .:|.|:|.::|..:|.|:...:.     |..|...|.|:
  Fly   336 -----------PNAIVRVTNLNQ---FVSNELLHQSFEIFGPIERAVICVDDRGKHTGEGIVEFA 386

  Fly   463 TKEAAT 468
            .|.:|:
  Fly   387 KKSSAS 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trvNP_001163754.3 RRM2_TIA1_like 313..387 CDD:240799 23/73 (32%)
RRM3_TIA1_like 416..491 CDD:240800 15/58 (26%)
nonA-lNP_001262646.1 RRM1_p54nrb_like 264..334 CDD:240778 23/75 (31%)
RRM2_p54nrb_like 339..418 CDD:240779 15/57 (26%)
NOPS_NONA_like 409..508 CDD:240580
OmpH <479..578 CDD:281871
DUF4472 479..559 CDD:291409
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.