Sequence 1: | NP_001163754.3 | Gene: | trv / 43362 | FlyBaseID: | FBgn0085391 | Length: | 651 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001262646.1 | Gene: | nonA-l / 42026 | FlyBaseID: | FBgn0015520 | Length: | 630 | Species: | Drosophila melanogaster |
Alignment Length: | 201 | Identity: | 48/201 - (23%) |
---|---|---|---|
Similarity: | 79/201 - (39%) | Gaps: | 56/201 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 290 GGGQDMED---SDEEMEYMPPLHK--------------QFHIFVGDLSSEIETQQLREAFTPFGE 337
Fly 338 ISDCRVVRDPQTLKSKGYGFVSFIKKSEAESAITAMNGQWLGSRSIRTNWATRKPPASKENIKPL 402
Fly 403 TFDEVYNQSSPSNCTVYVGGVNSALTALSEEVLQKTFAPYGAIQEIRVF-----KDKGYAFVRFS 462
Fly 463 TKEAAT 468 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
trv | NP_001163754.3 | RRM2_TIA1_like | 313..387 | CDD:240799 | 23/73 (32%) |
RRM3_TIA1_like | 416..491 | CDD:240800 | 15/58 (26%) | ||
nonA-l | NP_001262646.1 | RRM1_p54nrb_like | 264..334 | CDD:240778 | 23/75 (31%) |
RRM2_p54nrb_like | 339..418 | CDD:240779 | 15/57 (26%) | ||
NOPS_NONA_like | 409..508 | CDD:240580 | |||
OmpH | <479..578 | CDD:281871 | |||
DUF4472 | 479..559 | CDD:291409 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |