DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trv and Rbp4

DIOPT Version :9

Sequence 1:NP_001163754.3 Gene:trv / 43362 FlyBaseID:FBgn0085391 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster


Alignment Length:420 Identity:77/420 - (18%)
Similarity:134/420 - (31%) Gaps:145/420 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   314 IFVGDLSSEIETQQLREAFTPFGEISDCRVVRDPQTLKSKGYGFVSFIKKSEAESAITAMNGQWL 378
            ||:|.||::...:.||..|:.||.::|..|:|||.:..|:|:|||:::.....|..         
  Fly    34 IFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIV--------- 89

  Fly   379 GSRSIRTNWATRKPPASKENIKPLTFDEVYNQSS---PSNCTVYVGGVNSALTAL---------- 430
                              :..:|.|.|....::.   |.......|||.|.:.:.          
  Fly    90 ------------------QRARPHTIDNKIVETKHALPR
QDFKRGGGVGSVVGSFGCEAGFMNSK 136

  Fly   431 -----------SEEVLQKTFAPYGAIQEIRVFKD------KGYAFVRFSTKEAATHAIVGVHNTE 478
                       .|.::::.|:.:|.:..:::..|      :.:.|:.|....:|..|:.      
  Fly   137 RIFLGGLKEYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALA------ 195

  Fly   479 INAQPVKCSWGKESGDPNNAQTIATQALNSAAAAAAGFPYGVGAAAAAAAYGQQLAATGCWYSPT 543
                |.| .|        ..||: .:...|...|...|.:.:.::..|.....|.|....:....
  Fly   196 ----PRK-HW--------ILQTL-VEVKRSTQKADRRFRFPIFSSVRAGYIPPQPATADSYNYNN 246

  Fly   544 PTY---------PASSAT----------AAAVTPAAASAAAVQNQFL--QGIQGYHFGQYGGYQQ 587
            |.|         |.|:.|          |...||....||::.:|.|  ..:.|:....:..|.:
  Fly   247 PNYNPYLAQSVLPPSAFTNGWAHYVIPMAPKPTPGQNMAASLPSQQLAEHSLNGHGPDMWSSYPK 311

  Fly   588 GYMGMGVQIPATWQGVTQAQISP------AQ--------------QLAT---------------- 616
                .|:.....|.....|:..|      ||              |.||                
  Fly   312 ----TGIYSAQEWTSSKVAEWGPKAGHKHAQTSTNDRAKIDLKELQAATFNNKLDFGARGDADRM 372

  Fly   617 -------GVAGTAIPQAAGVVAYPIQQFQV 639
                   |:.|.|......:..:|.|.::|
  Fly   373 SGAGLGLGLTGGAAVGVGAIKKWPTQDYKV 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trvNP_001163754.3 RRM2_TIA1_like 313..387 CDD:240799 21/72 (29%)
RRM3_TIA1_like 416..491 CDD:240800 15/101 (15%)
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 24/102 (24%)
RRM2_hnRNPA_like 137..209 CDD:240774 13/91 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.