DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trv and tra2b

DIOPT Version :9

Sequence 1:NP_001163754.3 Gene:trv / 43362 FlyBaseID:FBgn0085391 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_957491.1 Gene:tra2b / 394172 ZFINID:ZDB-GENE-040426-1094 Length:278 Species:Danio rerio


Alignment Length:167 Identity:38/167 - (22%)
Similarity:67/167 - (40%) Gaps:48/167 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 YMPPLHKQFHIFVGD--------------LSSEIETQQLREAFTPFGEISDCRVVRDPQTLKSKG 354
            :.|..:::.||  ||              ||.....:.|||.|:.:|.:||..:|.|.|:.:|:|
Zfish   103 HSPMSNRRRHI--GDRANPDPNCCLGVFGLSLYTTERDLREVFSKYGPLSDVCIVYDQQSRRSRG 165

  Fly   355 YGFVSFIKKSEAESAITAMNGQWLGSRSIRTNWATRKPPASKENIKPLTFDEVYNQSSPSNCTVY 419
            :..|.|..:.:::.|....||..|..|.||.:::..|.|               :..:|.   :|
Zfish   166 FALVYFENREDSKEAKERANGMELDGRRIRVDYSITKGP---------------HTPTPG---IY 212

  Fly   420 VGGVNSALTALSEEVLQKTFAPYGAIQEIRVFKDKGY 456
            :|              :.|:....::...|...|:||
Zfish   213 MG--------------RPTYGGGPSVSRRRDSYDRGY 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trvNP_001163754.3 RRM2_TIA1_like 313..387 CDD:240799 27/87 (31%)
RRM3_TIA1_like 416..491 CDD:240800 7/41 (17%)
tra2bNP_957491.1 RRM_TRA2B 114..202 CDD:241085 25/87 (29%)
RRM <118..>199 CDD:223796 23/80 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.