DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trv and Srsf6

DIOPT Version :10

Sequence 1:NP_001163754.3 Gene:trv / 43362 FlyBaseID:FBgn0085391 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_001014207.2 Gene:Srsf6 / 362264 RGDID:1359241 Length:339 Species:Rattus norvegicus


Alignment Length:103 Identity:25/103 - (24%)
Similarity:48/103 - (46%) Gaps:9/103 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 HAARTEGGGQDMEDSDEEMEYMPPLHKQFHIFVGDLSSEIETQQLREAFTPFGEI--SDCRVVRD 346
            :.:|:.|||.....:....:|.||:..::.:.|.:|||....|.|::.....||:  :|....|.
  Rat    82 YGSRSGGGGYSSRRTSGRDKYGPPVRTEYRLIVENLSSRCSWQDLKDFMRQAGEVTYADAHKERT 146

  Fly   347 PQTLKSKGYGFVSFIKKSEAESAITAMNGQWLGSRSIR 384
            .:       |.:.|...|:.:.|:..::|..:..|:||
  Rat   147 NE-------GVIEFRSYSDMKRALDKLDGTEINGRNIR 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trvNP_001163754.3 RRM2_TIA1_like 313..387 CDD:409789 18/74 (24%)
RRM3_TIA1_like 416..489 CDD:409790
Srsf6NP_001014207.2 RRM_SF 1..72 CDD:473069
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..103 4/20 (20%)
RRM2_SRSF6 110..182 CDD:410159 18/75 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 176..339 2/2 (100%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.