DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trv and Tial1

DIOPT Version :9

Sequence 1:NP_001163754.3 Gene:trv / 43362 FlyBaseID:FBgn0085391 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_001013211.1 Gene:Tial1 / 361655 RGDID:1595845 Length:392 Species:Rattus norvegicus


Alignment Length:415 Identity:162/415 - (39%)
Similarity:205/415 - (49%) Gaps:116/415 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 AAAAVSAYQRNGKLPRNLPALRAMEMALRTNSFATPPAPHSLPLPPPHAARTEGGGQDMEDSDEE 301
            ||||::|  .||:        :.:...::.| :||.|:                 .|..:.|:  
  Rat    78 AAAALAA--MNGR--------KILGKEVKVN-WATTPS-----------------SQKKDTSN-- 112

  Fly   302 MEYMPPLHKQFHIFVGDLSSEIETQQLREAFTPFGEISDCRVVRDPQTLKSKGYGFVSFIKKSEA 366
                     .||:||||||.||.|:.::.||.|||:|||.|||:|..|.||||||||||..|.:|
  Rat   113 ---------HFHVFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSFYNKLDA 168

  Fly   367 ESAITAMNGQWLGSRSIRTNWATRKPPASKE----NIKPLTFDEVYNQSSPSNCTVYVGGVNSAL 427
            |:||..|.|||||.|.||||||||||||.|.    |.|.|.|::|.|||||.|||||.||:.|.|
  Rat   169 ENAIVHMGGQWLGGRQIRTNWATRKPPAPKSTQETNTKQLRFEDVVNQSSPKNCTVYCGGIASGL 233

  Fly   428 TALSEEVLQKTFAPYGAIQEIRVFKDKGYAFVRFSTKEAATHAIVGVHNTEINAQPVKCSWGKES 492
            |   ::::::||:|:|.|.|||||.:|||:||||||.|:|.||||.|:.|.|....|||.|||||
  Rat   234 T---DQLMRQTFSPFGQIMEIRVFPEKGYSFVRFSTHESAAHAIVSVNGTTIEGHVVKCYWGKES 295

  Fly   493 GDPNNAQTIATQALNSAAAAAAGFPYGVGAAAAAAAYGQQLAATGCWYSPTPTYPASSATAAAVT 557
            .|    .|...|.::.:........||     ....|||.:|                       
  Rat   296 PD----MTKNFQQVDYSQWGQWSQVYG-----NPQQYGQYMA----------------------- 328

  Fly   558 PAAASAAAVQNQFLQGIQGYHFGQYGGYQQGY--MGMGV-QIP-ATWQGVTQAQISPAQQLATGV 618
                             .|:....||.|.|.:  .|.|| |.| |.|.|...||  |.|      
  Rat   329 -----------------NGWQVPPYGVYGQPWNQQGFGVDQSPSAAWMGGFGAQ--PPQ------ 368

  Fly   619 AGTAIP-------QAA-GVVAYPIQ 635
             |.|.|       ||. |:.::|.|
  Rat   369 -GQAPPPVIPPPNQAGYGMASFPTQ 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trvNP_001163754.3 RRM2_TIA1_like 313..387 CDD:240799 48/73 (66%)
RRM3_TIA1_like 416..491 CDD:240800 42/74 (57%)
Tial1NP_001013211.1 RRM1_TIAR 10..107 CDD:410028 11/56 (20%)
RRM2_TIAR 113..192 CDD:410029 52/78 (67%)
RRM3_TIAR 222..294 CDD:241064 42/74 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 99 1.000 Domainoid score I6881
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1066369at2759
OrthoFinder 1 1.000 - - FOG0000924
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10352
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X831
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.020

Return to query results.
Submit another query.