DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trv and hnrnpa0a

DIOPT Version :9

Sequence 1:NP_001163754.3 Gene:trv / 43362 FlyBaseID:FBgn0085391 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_997810.2 Gene:hnrnpa0a / 323529 ZFINID:ZDB-GENE-030131-2249 Length:305 Species:Danio rerio


Alignment Length:294 Identity:70/294 - (23%)
Similarity:113/294 - (38%) Gaps:78/294 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   314 IFVGDLSSEIETQQLREAFTPFGEISDCRVVRDPQTLKSKGYGFVSFIKKSEAESAITA----MN 374
            :|||.|:.:.....||..|..:|:::||.||::.|..:|:.:|||::....||:||::|    ::
Zfish    12 LFVGGLNVQTTDDGLRNHFEQYGKLTDCVVVQNQQLKRSRCFGFVTYSSPDEADSAMSARPHILD 76

  Fly   375 GQWLGSRSIRTNWATRKPPASKENIKPLTFDEVYNQSSPSNCTVYVGGVNSALTALSEEVLQKTF 439
            |         .|...::..|.::..||....:|..        :::||:..   .:.|:.|:..|
Zfish    77 G---------NNVELKRAV
AREDAGKPEALAKVKK--------IFIGGLKD---DIEEDHLRDCF 121

  Fly   440 APYGAIQEIRVFKDK------GYAFVRFSTKEAATHA------IVGVHNTEINAQPVKCSWGKES 492
            :.:||:::..|..||      |:.||.|...::|..|      |:..|..|     ||.:..|:.
Zfish   122 SQFGAVEKAEVITDKETGKKRGFGFVYFEDNDSADKAVVLKFHIINGHKVE-----VKKALTKQE 181

  Fly   493 GDPNNAQTIATQALNSAAAAAAGFPYGVGAAAAAAAYGQQLAATGCWYSPTPTYPASSATAAAVT 557
                      .||..|......|...|.|.......||.:....|       .|....       
Zfish   182 ----------MQAAGSRGGGRGGRGGGRGMGRPQNGYGGRGGGYG-------NYGGGG------- 222

  Fly   558 PAAASAAAVQNQFLQGIQGYHFGQYGGYQQGYMG 591
                         ..|..||..|..|||..||.|
Zfish   223 -------------YGGNDGYGGGYGGGYGGGYGG 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trvNP_001163754.3 RRM2_TIA1_like 313..387 CDD:240799 23/76 (30%)
RRM3_TIA1_like 416..491 CDD:240800 21/86 (24%)
hnrnpa0aNP_997810.2 RRM1_hnRNPA0 8..86 CDD:240772 24/82 (29%)
RRM_SF 102..181 CDD:302621 22/94 (23%)
HnRNPA1 260..286 CDD:288479
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.