DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trv and TRA2A

DIOPT Version :10

Sequence 1:NP_001163754.3 Gene:trv / 43362 FlyBaseID:FBgn0085391 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_037425.1 Gene:TRA2A / 29896 HGNCID:16645 Length:282 Species:Homo sapiens


Alignment Length:73 Identity:25/73 - (34%)
Similarity:41/73 - (56%) Gaps:0/73 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 LSSEIETQQLREAFTPFGEISDCRVVRDPQTLKSKGYGFVSFIKKSEAESAITAMNGQWLGSRSI 383
            ||.....:.|||.|:.:|.:|...||.|.:|.:|:|:.||.|.:..:::.|:...||..|..|.|
Human   126 LSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERANGMELDGRRI 190

  Fly   384 RTNWATRK 391
            |.:::..|
Human   191 RVDYSITK 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trvNP_001163754.3 RRM2_TIA1_like 313..387 CDD:409789 24/67 (36%)
RRM3_TIA1_like 416..489 CDD:409790
TRA2ANP_037425.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..118
RRM_TRA2 118..197 CDD:409798 24/70 (34%)
Linker 198..225 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..245
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..282
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.