DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trv and csx1

DIOPT Version :9

Sequence 1:NP_001163754.3 Gene:trv / 43362 FlyBaseID:FBgn0085391 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_594243.1 Gene:csx1 / 2542151 PomBaseID:SPAC17A2.09c Length:632 Species:Schizosaccharomyces pombe


Alignment Length:361 Identity:96/361 - (26%)
Similarity:154/361 - (42%) Gaps:52/361 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 QFHIFVGDLSSEIETQQLREAFTPFGEI----SDCRVVRDPQTLKSKGYGFVSFIKKSEAESAIT 371
            :|.||||||   :.|.:..:.|..|..|    :..:::.||.|..|:.||||.|..:.|.:.|:.
pombe   181 EFSIFVGDL---LPTTEDSDLFMTFRSIYPSCTSAKIIVDPVTGLSRKYGFVRFSSEKEQQHALM 242

  Fly   372 AMNGQWLGSRSIRTNWATRKP-------------PASKENIKPLTFDEVYNQS----SPSNCTVY 419
            .|.|.....|.:|.:.|:.|.             |.|..|.:|       ||.    .|.|.||:
pombe   243 HMQGYLCQGRPLRISVASPKSRASIAADSALGIVPTSTSNRQP-------NQDLCSMDPLNTTVF 300

  Fly   420 VGGVNSALTALSEEVLQKTFAPYGAIQEIRVFKDKGYAFVRFSTKEAATHAIVGVHNTEINAQPV 484
            |||:.|   .|||:.||..|.|:|.|..|::...||..||::|.|.||..||..:....:....:
pombe   301 VGGLAS---NLSEKDLQVCFQPFGRILNIKIPFGKGCGFVQYSEKSAAEKAINTMQGALVGTSHI 362

  Fly   485 KCSWGKESGDPNNAQTIATQALNSAAAAAAGFPYGVGAAAAAAAYGQQLAATGCWYSPTPTYPAS 549
            :.:||      :|...::..:.:.:..:..||.   ...:|...:|...:..|. .|.:.....|
pombe   363 RLAWG------HNTLPVSALSQSQSQVSDEGFD---RTLSANQIFGMNQSVIGA-NSGSSNSSGS 417

  Fly   550 SATAAAVTP-AAASAAAVQNQFLQGIQGYHFGQYGGYQQGYMGMGVQIPATWQGVTQAQISPAQ- 612
            |..:|.|:| .||:.:.:.|..:..|.|.:...:.......:.....|..|..| :.:.::|.. 
pombe   418 SLKSAPVSPRTAAAQSLLPNSVVSSINGMNSVNFSTISPPPLSRSASISPTLSG-SGSGLTPLSS 481

  Fly   613 ---QLATG-VAGTAIPQAAGVVAYPIQ-QFQVSPQV 643
               ..||| |.|...||::.:.:..|. ..:|.|.|
pombe   482 HFPSAATGLVGGQVYPQSSVLQSSKINGSAKVQPSV 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trvNP_001163754.3 RRM2_TIA1_like 313..387 CDD:240799 25/77 (32%)
RRM3_TIA1_like 416..491 CDD:240800 28/74 (38%)
csx1NP_594243.1 RRM 67..367 CDD:223796 62/198 (31%)
RRM1_NGR1_NAM8_like 86..168 CDD:241055
RRM2_NGR1_NAM8_like 181..260 CDD:241057 26/81 (32%)
half-pint <217..>577 CDD:130706 85/322 (26%)
RRM3_NGR1_NAM8_like 296..367 CDD:240792 27/73 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 112 1.000 Inparanoid score I1562
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.