DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trv and Tia1

DIOPT Version :9

Sequence 1:NP_001163754.3 Gene:trv / 43362 FlyBaseID:FBgn0085391 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_035715.1 Gene:Tia1 / 21841 MGIID:107914 Length:386 Species:Mus musculus


Alignment Length:409 Identity:165/409 - (40%)
Similarity:209/409 - (51%) Gaps:91/409 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 AAAAVSAYQRNGKLPRNLPALRAMEMALRTNSFATPPAPHSLPLPPPHAARTEGGGQDMEDSDEE 301
            ||||::|  .||:        :.|...::.| :||.|:                 .|..:.|...
Mouse    59 AAAALAA--MNGR--------KIMGKEVKVN-WATTPS-----------------SQKKDTSSST 95

  Fly   302 MEYMPPLHKQFHIFVGDLSSEIETQQLREAFTPFGEISDCRVVRDPQTLKSKGYGFVSFIKKSEA 366
            :.........||:||||||.||.|:.::.||.|||.|||.|||:|..|.||||||||||..|.:|
Mouse    96 VVSTQRSQDHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDA 160

  Fly   367 ESAITAMNGQWLGSRSIRTNWATRKPPASK----ENIKPLTFDEVYNQSSPSNCTVYVGGVNSAL 427
            |:||..|.|||||.|.||||||||||||.|    .|.|.|::|||.:||||:|||||.|||.|.|
Mouse   161 ENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVSQSSPNNCTVYCGGVTSGL 225

  Fly   428 TALSEEVLQKTFAPYGAIQEIRVFKDKGYAFVRFSTKEAATHAIVGVHNTEINAQPVKCSWGKES 492
            |   |:::::||:|:|.|.|||||.||||:|||||:.|:|.||||.|:.|.|....|||.||||:
Mouse   226 T---EQLMRQTFSPFGQIMEIRVFPDKGYSFVRFSSHESAAHAIVSVNGTTIEGHVVKCYWGKET 287

  Fly   493 GDPNNAQTIATQALNSAAAAAAGFPYGVGAAAAAAAYGQQLAATGCWYSPTPTYPASSATAAAVT 557
            .|..|    ..|..|.     .|:|         ..|||    .|.||                 
Mouse   288 LDMIN----PVQQQNQ-----IGYP---------PTYGQ----WGQWY----------------- 313

  Fly   558 PAAASAAAVQNQFLQGIQGYHFGQYGGYQQGYMGMG---VQIPATWQGVTQAQISPAQQLATGVA 619
               .:|..: .|::.  .|:....||.|.|.:...|   .|..|.|.|...: :.|.|    |..
Mouse   314 ---GNAQQI-GQYVP--NGWQVPAYGVYGQPWSQQGFNQTQSSAPWMGPNYS-VPPPQ----GQN 367

  Fly   620 GTAIP-QAAG--VVAYPIQ 635
            |:.:| |.||  |..|..|
Mouse   368 GSMLPSQPAGYRVAGYETQ 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trvNP_001163754.3 RRM2_TIA1_like 313..387 CDD:240799 48/73 (66%)
RRM3_TIA1_like 416..491 CDD:240800 44/74 (59%)
Tia1NP_035715.1 ELAV_HUD_SF 6..280 CDD:273741 123/251 (49%)
RRM1_TIA1 8..81 CDD:241059 9/32 (28%)
RRM2_TIA1 105..184 CDD:241062 52/78 (67%)
RRM3_TIA1 214..287 CDD:241065 45/75 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 355..376 7/25 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 99 1.000 Domainoid score I7056
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000924
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10352
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X831
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.010

Return to query results.
Submit another query.