DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trv and rnp-9

DIOPT Version :9

Sequence 1:NP_001163754.3 Gene:trv / 43362 FlyBaseID:FBgn0085391 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_001359585.1 Gene:rnp-9 / 182350 WormBaseID:WBGene00007396 Length:312 Species:Caenorhabditis elegans


Alignment Length:312 Identity:118/312 - (37%)
Similarity:164/312 - (52%) Gaps:62/312 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 LPSRTPATP-------PLPGTY-----------RVQSLKSAAAAAVSAYQRNGKLPRNLPALRAM 260
            ||:.||.|.       |:...|           .:|||.:......:|         :||:|..:
 Worm     3 LPTATPQTSLLYSQQMPMKNLYSQFPAGLLDTQSIQSLDTCPLLLQTA---------SLPSLSHI 58

  Fly   261 EMALRTNSFATPPAPHSLPLPPPHAARTEGGGQDMEDSDEEMEYMPPLHKQFHIFVGDLSSEIET 325
            .:            ||||.....|:|           |:..||......|.||:||||||.::..
 Worm    59 GL------------PHSLESAVLHSA-----------SEPPMEMRIDTSKHFHVFVGDLSKDVSN 100

  Fly   326 QQLREAFTPFGEISDCRVVRDPQTLKSKGYGFVSFIKKSEAESAITAMNGQWLGSRSIRTNWATR 390
            :.|:..||.|||:|:.:|:||.||.||||||||||..|..||:||..|||:|:|.|::|||||.|
 Worm   101 ELLKSTFTKFGEVSEAKVIRDVQTQKSKGYGFVSFPNKQNAENAIAGMNGKWIGKRAVRTNWAAR 165

  Fly   391 KPPASKENIKPLTFDEVYNQSSPSNCTVYVGGVNSALTALSEEVLQKTFAPYGAIQEIRVFKDKG 455
            |  .|:||...|||::|:|.:...|.:||||.::...|   :..|:..|:.||.|.|:|:||.:.
 Worm   166 K--NSEENRDKLTFEQVFNSTKADNTSVYVGNISQQTT---DADLRDLFSTYGDIAEVRIFKTQR 225

  Fly   456 YAFVRFSTKEAATHAIVGVHNTEINAQPVKCSWGKESGDPNNAQTIATQALN 507
            |||||:..||.||.||:.::..|:....|:||||:....||       ||||
 Worm   226 YAFVRYEKKECATKAIMEMNGKEMAGNQVRCSWGRTQAVPN-------QALN 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trvNP_001163754.3 RRM2_TIA1_like 313..387 CDD:240799 42/73 (58%)
RRM3_TIA1_like 416..491 CDD:240800 31/74 (42%)
rnp-9NP_001359585.1 RRM2_TIA1_like 88..162 CDD:240799 42/73 (58%)
RRM3_TIA1_like 189..260 CDD:240800 30/73 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I7055
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1066369at2759
OrthoFinder 1 1.000 - - FOG0000924
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.