DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trv and hrpa-2

DIOPT Version :9

Sequence 1:NP_001163754.3 Gene:trv / 43362 FlyBaseID:FBgn0085391 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_741783.1 Gene:hrpa-2 / 180791 WormBaseID:WBGene00019249 Length:336 Species:Caenorhabditis elegans


Alignment Length:289 Identity:74/289 - (25%)
Similarity:115/289 - (39%) Gaps:67/289 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 MMQPPPLPPSPMMPPQSFGCPLPSRTPATPPLPGTYRVQSLKSAAAAAVSAYQRNGKLPRNLPAL 257
            |..|.|.||......||.|.|........||.|                   |.||     .|.:
 Worm     1 MYGPYPYPPEVAEMIQSGGFPFAMMNRGMPPPP-------------------QWNG-----YPVI 41

  Fly   258 RAMEMALRTNSFATPPAPHSLPLPPPHAARTEGGGQDMEDSDEEMEYMPPLHKQFHIFVGDLSSE 322
            ...|:......|                 :..|.||...||.      |.|.|   :|:|.||.:
 Worm    42 HPYELHQMLRQF-----------------QQMGMGQYQHDSP------PQLRK---LFIGGLSHD 80

  Fly   323 IETQQLREAFTPFGEISDCRVVRDPQTLKSKGYGFVSFIKKSEAESAITAMNGQ--WLGSRSIRT 385
            ...:||...|:.:|.:.|..|:|||.|..|:|:|||:|.....|||   |||.:  .||.:::.:
 Worm    81 TTDEQLGNYFSQWGPVVDAIVIRDPNTKHSRGFGFVTFASIFSAES---AMNDRPHKLGGKTVDS 142

  Fly   386 NWATRKPPASKENIKPLTFDEVYNQSSPS-NCTVYVGGVNSALTALSEEVLQKTFAPYGAIQEIR 449
            ..|.  |.....::.|..|.|    :.|: .|.:.:.|:.:.:.  |.:.|:..|..:|.:.::.
 Worm   143 KRAI--PREQMSSMIPPPFFE----TDPAPGCKLLLNGITNGVH--SVDSLRVYFETFGTLDQVE 199

  Fly   450 VF-KDKGYAFVRFSTKEAATHAIVGVHNT 477
            :. :.:|..||.:..||:|...:  .||:
 Worm   200 ILGQPRGLGFVIYEDKESADRCL--AHNS 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trvNP_001163754.3 RRM2_TIA1_like 313..387 CDD:240799 28/75 (37%)
RRM3_TIA1_like 416..491 CDD:240800 14/63 (22%)
hrpa-2NP_741783.1 RRM <62..230 CDD:223796 53/187 (28%)
RRM1_hnRNPA_like 71..148 CDD:241022 30/84 (36%)
RRM_SF 183..240 CDD:302621 11/46 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.