DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trv and Srsf10

DIOPT Version :10

Sequence 1:NP_001163754.3 Gene:trv / 43362 FlyBaseID:FBgn0085391 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_001073856.1 Gene:Srsf10 / 14105 MGIID:1333805 Length:262 Species:Mus musculus


Alignment Length:110 Identity:30/110 - (27%)
Similarity:53/110 - (48%) Gaps:7/110 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 YMPPLHKQFHIFVGDLSSEIETQQLREAFTPFGEISDCRVVRDPQTLKSKGYGFVSFIKKSEAES 368
            |:.|.:..  :||.:::.:..::.||..|..:|.|.|..|..|..|.:.:|:.:|.|....:||.
Mouse     4 YLRPPNTS--LFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAED 66

  Fly   369 AITAMNGQWLGSRSIRTNWA--TRKPPASKENIKPLTFDEVYNQS 411
            |:..::.:|:..|.|...:|  .||.|   ..:|......||:.|
Mouse    67 ALHNLDRKWICGRQIEIQFAQGDRKTP---NQMKAKEGRNVYSSS 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trvNP_001163754.3 RRM2_TIA1_like 313..387 CDD:409789 20/73 (27%)
RRM3_TIA1_like 416..489 CDD:409790
Srsf10NP_001073856.1 RRM_SF 5..99 CDD:473069 26/98 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..262
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.