DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trv and Tra2a

DIOPT Version :9

Sequence 1:NP_001163754.3 Gene:trv / 43362 FlyBaseID:FBgn0085391 Length:651 Species:Drosophila melanogaster
Sequence 2:XP_006505303.1 Gene:Tra2a / 101214 MGIID:1933972 Length:309 Species:Mus musculus


Alignment Length:204 Identity:44/204 - (21%)
Similarity:80/204 - (39%) Gaps:35/204 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 GCP----LPSRTPATPPLPGTYRVQSLKSAAAAAVS-------AYQRNGKLPRNLPALRAMEMAL 264
            |.|    :.||:.:..|.....||:|...:.:.:.|       ::.|:....|:.....:.....
Mouse    32 GAPSGRIVESRSQSKSPTGTPARVKSESRSGSRSPSRVSKHSESHSRSRSKSRSRSRRHSHRRYT 96

  Fly   265 RTNSFATPPAPHSLPLPPPHAARTEGGGQDMEDSDEEMEYMPPLHKQFH------------IFVG 317
            |:.|.:......|....|.:..|            ....:.|..:::.|            :.|.
Mouse    97 RSRSHSHRRRSRSRSYTPEYRRR------------RSRSHSPMSNRRRHTGSRANPDPNTCLGVF 149

  Fly   318 DLSSEIETQQLREAFTPFGEISDCRVVRDPQTLKSKGYGFVSFIKKSEAESAITAMNGQWLGSRS 382
            .||.....:.|||.|:.:|.:|...||.|.:|.:|:|:.||.|.:..:::.|:...||..|..|.
Mouse   150 GLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERANGMELDGRR 214

  Fly   383 IRTNWATRK 391
            ||.:::..|
Mouse   215 IRVDYSITK 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trvNP_001163754.3 RRM2_TIA1_like 313..387 CDD:240799 26/85 (31%)
RRM3_TIA1_like 416..491 CDD:240800
Tra2aXP_006505303.1 RRM_TRA2 143..222 CDD:409798 25/78 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.