Sequence 1: | NP_001163754.3 | Gene: | trv / 43362 | FlyBaseID: | FBgn0085391 | Length: | 651 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006505303.1 | Gene: | Tra2a / 101214 | MGIID: | 1933972 | Length: | 309 | Species: | Mus musculus |
Alignment Length: | 204 | Identity: | 44/204 - (21%) |
---|---|---|---|
Similarity: | 80/204 - (39%) | Gaps: | 35/204 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 211 GCP----LPSRTPATPPLPGTYRVQSLKSAAAAAVS-------AYQRNGKLPRNLPALRAMEMAL 264
Fly 265 RTNSFATPPAPHSLPLPPPHAARTEGGGQDMEDSDEEMEYMPPLHKQFH------------IFVG 317
Fly 318 DLSSEIETQQLREAFTPFGEISDCRVVRDPQTLKSKGYGFVSFIKKSEAESAITAMNGQWLGSRS 382
Fly 383 IRTNWATRK 391 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
trv | NP_001163754.3 | RRM2_TIA1_like | 313..387 | CDD:240799 | 26/85 (31%) |
RRM3_TIA1_like | 416..491 | CDD:240800 | |||
Tra2a | XP_006505303.1 | RRM_TRA2 | 143..222 | CDD:409798 | 25/78 (32%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |