DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trv and zcrb1

DIOPT Version :9

Sequence 1:NP_001163754.3 Gene:trv / 43362 FlyBaseID:FBgn0085391 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_001107973.1 Gene:zcrb1 / 100135752 XenbaseID:XB-GENE-999756 Length:215 Species:Xenopus tropicalis


Alignment Length:197 Identity:39/197 - (19%)
Similarity:76/197 - (38%) Gaps:58/197 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   314 IFVGDLSSEIETQQLREAFTPFGEISDCRVVRDPQTLKSKGYGFVSFIKKSEAESAITAMNGQWL 378
            ::|.:|...:....|...|:.:|::....:::|..:.:|||..||.|:.|..:::.:..:|.:.|
 Frog    12 VYVSNLPFSLTNNDLHRIFSKYGKVVKVTILKDKDSRRSKGVAFVLFLDKESSQNCVRGLNNKQL 76

  Fly   379 GSRSIRTNWA----------------------------------------TRKPPASKE--NIKP 401
            ..|:|:.:.|                                        .|:||..||  ..|.
 Frog    77 FGRAIKASIAIDNGRATEFIRRRNYTDKSRCYECGDTGHLSYACPKNMLGEREPPQKKEKKKRKK 141

  Fly   402 LTFDEVYNQSSPSNCTVYVGGVNSALTALSEEVLQKTFAPYGAIQEIRVFKDKGYAFVRFSTKEA 466
            :...||:.:....:     .|.:.||.:||:.:         |.|:.|:.::|..  .|....||
 Frog   142 IVEAEVFEEDESED-----EGEDPALDSLSQAI---------AFQQARIEEEKNK--YRHDAAEA 190

  Fly   467 AT 468
            :|
 Frog   191 ST 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trvNP_001163754.3 RRM2_TIA1_like 313..387 CDD:240799 17/72 (24%)
RRM3_TIA1_like 416..491 CDD:240800 13/53 (25%)
zcrb1NP_001107973.1 RRM_ZCRB1 9..86 CDD:240839 17/73 (23%)
PTZ00368 <97..123 CDD:173561 0/25 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.