Sequence 1: | NP_001163754.3 | Gene: | trv / 43362 | FlyBaseID: | FBgn0085391 | Length: | 651 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001107973.1 | Gene: | zcrb1 / 100135752 | XenbaseID: | XB-GENE-999756 | Length: | 215 | Species: | Xenopus tropicalis |
Alignment Length: | 197 | Identity: | 39/197 - (19%) |
---|---|---|---|
Similarity: | 76/197 - (38%) | Gaps: | 58/197 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 314 IFVGDLSSEIETQQLREAFTPFGEISDCRVVRDPQTLKSKGYGFVSFIKKSEAESAITAMNGQWL 378
Fly 379 GSRSIRTNWA----------------------------------------TRKPPASKE--NIKP 401
Fly 402 LTFDEVYNQSSPSNCTVYVGGVNSALTALSEEVLQKTFAPYGAIQEIRVFKDKGYAFVRFSTKEA 466
Fly 467 AT 468 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
trv | NP_001163754.3 | RRM2_TIA1_like | 313..387 | CDD:240799 | 17/72 (24%) |
RRM3_TIA1_like | 416..491 | CDD:240800 | 13/53 (25%) | ||
zcrb1 | NP_001107973.1 | RRM_ZCRB1 | 9..86 | CDD:240839 | 17/73 (23%) |
PTZ00368 | <97..123 | CDD:173561 | 0/25 (0%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |