DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trv and srsf4

DIOPT Version :9

Sequence 1:NP_001163754.3 Gene:trv / 43362 FlyBaseID:FBgn0085391 Length:651 Species:Drosophila melanogaster
Sequence 2:XP_004911639.2 Gene:srsf4 / 100038227 XenbaseID:XB-GENE-493077 Length:741 Species:Xenopus tropicalis


Alignment Length:184 Identity:41/184 - (22%)
Similarity:73/184 - (39%) Gaps:33/184 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   314 IFVGDLSSEIETQQLREAFTPFGEISDCRVVRDPQTLKSKGYGFVSFIKKSEAESAITAMNGQWL 378
            :::|.||.....:.:...|..||:|.:.       .||: |||||.|....:||.|:..|||:.|
 Frog     9 VYIGRLSHRARERDVERFFKGFGKIVEV-------DLKN-GYGFVEFEDSRDAEDAVYEMNGREL 65

  Fly   379 ------------GSRSIRTNWATRKPPASKENIKPLTFDEVYNQSSPSNCTVYVGGVNSALTALS 431
                        ..|.||:.:..||..:.|......|...:..::..|.|         :...|.
 Frog    66 CGERVIVEHARA
PRRDIRSGYGYRKGGSDKYGPPVRTMYRLRVENLSSRC---------SWQDLK 121

  Fly   432 EEVLQKTFAPYGAIQEIRVFKDKGYAFVRFSTKEAATHAIVGVHNTEINAQPVK 485
            :.:.|.....|....:.|  :::|  .:.|.:......|:..:..:|||.:.::
 Frog   122 DFMRQAGEVTYADAHQRR--QNEG--VIEFRSYSDMRRALEKLDGSEINGRKIQ 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trvNP_001163754.3 RRM2_TIA1_like 313..387 CDD:240799 25/84 (30%)
RRM3_TIA1_like 416..491 CDD:240800 11/70 (16%)
srsf4XP_004911639.2 RRM_SF 6..77 CDD:418427 22/75 (29%)
RRM_SF 104..176 CDD:418427 12/81 (15%)
ser_rich_anae_1 <249..>456 CDD:411418
PRK12678 352..>573 CDD:237171
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.