DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4815 and CG18420

DIOPT Version :9

Sequence 1:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:296 Identity:70/296 - (23%)
Similarity:115/296 - (38%) Gaps:77/296 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GWTLVRLLL----ILNSVR---TEAGNREEWTGRFHPRIYNGIKTTVESLGGVGIQLFNGRKLVC 61
            |...:.|||    :|.|.:   :|.|.|...  :..|||.||......|...:.....:..:.:|
  Fly     7 GMASILLLLTVFPLLGSTQFLDSECGTRSPL--KLGPRIVNGKVAVRNSSPWMAFLHTSSNQFIC 69

  Fly    62 SATLLTPRHILTAAHCF-----------------------ENLNRSKFHVIGGKSAEFTWHGNNF 103
            ..||::.|.:|||||||                       ..:||:..|    :..:...|.|:.
  Fly    70 GGTLISRRLVLTAAHCFIPNTTIVVRLGEYNRKLKGYREEHQVNRTFQH----RFYDPNTHANDI 130

  Fly   104 NKNKLIRVQIHPKY-AKMKFIADVAVAKTKYPLRSKYIGYAQLCRSVLHPRDKLIAAGWGFEGGV 167
               .|:|:..:..| |.::.|..:..|..|:.:.|..:               |...|||....:
  Fly   131 ---ALLRLVSNVVYKANIRPICIMWDASWKHHIDSIKV---------------LTGTGWGRTESM 177

  Fly   168 WDESRKKTFRSMKVGIVSKRDCEKQLDRKMPPNIICAGAYNNKTLCFGDSGGPLLLGRQVCGINT 232
            .|.|..:|..      :|::..:......:..|..|||.:|: .||.||:|||  :|..|...|.
  Fly   178 HDSSELRTLD------ISRQPSKMCAFGSVLSNQFCAGNWNS-NLCIGDTGGP--VGAMVRYRNA 233

  Fly   233 WTF----------KCGNNEKPDVYMGVRYYAKFIKR 258
            :.|          :|   ::|.|:..|..:.:||:|
  Fly   234 FRFVQVGIAITNKRC---QRPSVFTDVMSHIEFIRR 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 55/244 (23%)
Trypsin 49..256 CDD:278516 52/240 (22%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 57/255 (22%)
Tryp_SPc 43..267 CDD:238113 59/258 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436629
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.