DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTub97EF and TUBA4B

DIOPT Version :9

Sequence 1:NP_001163753.1 Gene:betaTub97EF / 43359 FlyBaseID:FBgn0003890 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001342150.1 Gene:TUBA4B / 80086 HGNCID:18637 Length:241 Species:Homo sapiens


Alignment Length:189 Identity:79/189 - (41%)
Similarity:117/189 - (61%) Gaps:7/189 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 QLFRPDNFVYGQSGAGNNWAKGHYTEGAELIDSVLEVLRKESEGCDCLQGFQLAHSLGGGTGSGL 147
            |:|.|:..:.|:..|.||:|.||||.|.|.||.:|:.:||.::.|..||||.:.||||.||||.:
Human    24 QIFHPEQLITGKEDAANNYAWGHYTIGKEFIDLLLDRIRKLADQCTGLQGFLVFHSLGRGTGSDV 88

  Fly   148 GTLLISKIREEYPDRIMNSFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETFCIDNEALYDICF 212
            .:.|:..:...|..:....||:.|:|:||..:|:|||:.|:.|..:|::|..|.:||:|:||||.
Human    89 TSFLMEWLSVNYGKKSKLGFSIYPAPQVSTAMVQPYNSILTTHTTLEHSDCAFMVDNKAIYDICH 153

  Fly   213 RTLKLSSPTYGDLNHLVSVTMSGVTTCLRFPGQLNADLRKLAVNMV-------PFPRLH 264
            ..|.:..|||.:||.|:|..:|.:|..|||.|.||.||.:...|:|       |:|.:|
Human   154 CNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVSYLTSTSPWPPMH 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTub97EFNP_001163753.1 PLN00220 1..444 CDD:215107 79/189 (42%)
beta_tubulin 2..426 CDD:276956 79/189 (42%)
TUBA4BNP_001342150.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Tubulin 20..>207 CDD:330767 76/182 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53784
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.