DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTub97EF and tubd1

DIOPT Version :9

Sequence 1:NP_001163753.1 Gene:betaTub97EF / 43359 FlyBaseID:FBgn0003890 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001006747.1 Gene:tubd1 / 448419 XenbaseID:XB-GENE-488049 Length:451 Species:Xenopus tropicalis


Alignment Length:471 Identity:122/471 - (25%)
Similarity:205/471 - (43%) Gaps:77/471 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IVHLQAGQCGNQIGSKFWEII-SDEHGIDP-------NGYYHGESALQHERIDVYYNEASSGKYV 60
            :|.:|.||||||:|.:|::|: ||.|. .|       |.||......|      :::|...|..|
 Frog     3 VVTVQLGQCGNQVGYEFFDILCSDLHS-KPGHSTKRENDYYQTVCKEQ------FFHEEECGDLV 60

  Fly    61 PRAVLIDLEPGTMDSVRQSPVGQLFRPDNFVYG-------QSGAGNNWAKGHYTEGAELIDSVLE 118
            .||||:|:||    .|....:....|...:.|.       :.|.|||||.|:...|.:..|.|::
 Frog    61 TRAVLVDMEP----KVVSKTLSMAGRSGKWKYDISSQFSQKQGCGNNWANGYCVHGPKHQDIVMD 121

  Fly   119 VLRKESEGCDCLQGFQLAHSLGGGTGSGLGTLLISKIREEYPDRIMNSFSVVPSPKVSDTVVEPY 183
            ::||:.|.||.|.||....|:.||||||:||.|...:|:.|||.::.:..:.|. ...:.:|:.|
 Frog   122 LVRKQVEKCDRLGGFFTIMSMAGGTGSGMGTFLTRCLRDAYPDSLLLNQVIWPY-GTGEVIVQNY 185

  Fly   184 NATLSIHQLVENTDETFCIDNEALYDICFRTLKLSSPTYGDLNHLVSVTMSGVTT---------- 238
            |:.|::..|..::|.....:|:.::.:|.:.:.:...::.|:|.:::..:..:..          
 Frog   186 NSILTLSHLYRSSDALLVHENDIIHKVCSQLMNIKQISFRDVNKVIAHQLGSIFQPVYTSEEALH 250

  Fly   239 -CLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTAKGSQQYRALT---VAELTQQMFDAKNM 299
             | |.|      |.:|...:||.|..........|..::.|..|....   :.:..:||..|...
 Frog   251 YC-RNP------LGELMECLVPHPEYKMLGLRNIPQMSEHSLAYSTFNWNGLLKHLRQMLIANAK 308

  Fly   300 MTACDPRHGR------------------YLTVA--CIFRGPMSMKEVDTQMYNVQS-KNSSYFVE 343
            |......|.|                  ..:||  .|.||.      |.|..:::. ::...:..
 Frog   309 MEEGINWHVRPPSQPTAEKTSLRKELQFNTSVANLAILRGK------DVQTASLEGFRDPPLYTP 367

  Fly   344 WIPNNVKVAVCDIPP--RGLKMSATFIGNSTAIQEIFKRISEQFTAMFRRKAFLHWYTGEGMDEM 406
            |:..:....:...|.  ...:.|||.:.||..:.:....|..:...||..||::|.||..|:||.
 Frog   368 WLSPDDAFTLWKTPRAFNKYEKSATLVSNSQFLLKPLDNIVGKAWNMFASKAYVHQYTKFGIDEE 432

  Fly   407 EFTEAESNMNDLISEY 422
            ||.|..:.:..:|:.|
 Frog   433 EFLETFTTLEQIIASY 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTub97EFNP_001163753.1 PLN00220 1..444 CDD:215107 122/471 (26%)
beta_tubulin 2..426 CDD:276956 122/471 (26%)
tubd1NP_001006747.1 delta_zeta_tubulin-like 2..450 CDD:276958 122/471 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.