DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTub97EF and Y19D2B.1

DIOPT Version :9

Sequence 1:NP_001163753.1 Gene:betaTub97EF / 43359 FlyBaseID:FBgn0003890 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_496352.1 Gene:Y19D2B.1 / 189479 WormBaseID:WBGene00012489 Length:85 Species:Caenorhabditis elegans


Alignment Length:80 Identity:32/80 - (40%)
Similarity:49/80 - (61%) Gaps:8/80 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   368 IGNSTAIQEIFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLISEYQQYQEATADD 432
            :.::|||.|.:.|:..:|..|:.::||:|||.||||:|.|||||.   .||.:..:.|:|..|| 
 Worm    13 LSDTTAIAEAWSRLDYKFDLMYAKRAFVHWYVGEGMEEGEFTEAR---EDLAALEKDYEEVGAD- 73

  Fly   433 EVEFDDEQAEQEGYE 447
                .:|..|::|.|
 Worm    74 ----SNEGLEEDGEE 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTub97EFNP_001163753.1 PLN00220 1..444 CDD:215107 30/75 (40%)
beta_tubulin 2..426 CDD:276956 24/57 (42%)
Y19D2B.1NP_496352.1 Tubulin_FtsZ_Cetz-like <9..70 CDD:299146 25/59 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.