DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4849 and eEF1alpha2

DIOPT Version :9

Sequence 1:NP_651605.1 Gene:CG4849 / 43358 FlyBaseID:FBgn0039566 Length:975 Species:Drosophila melanogaster
Sequence 2:NP_524611.1 Gene:eEF1alpha2 / 43736 FlyBaseID:FBgn0000557 Length:462 Species:Drosophila melanogaster


Alignment Length:199 Identity:50/199 - (25%)
Similarity:82/199 - (41%) Gaps:35/199 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 NVALVGHLHHGKTTFVDCLI-------RQTHPQFE----TMEERQLRYT---DTLFTEQERGCSI 183
            |:.::||:..||:|....||       ::|..:||    .|.:...:|.   |.|..|:|||.:|
  Fly     9 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITI 73

  Fly   184 KATPVTLVLQDVKQKSYLLNIFDTPGHVNFSDEATAAMRMSDGVVLFIDAA-----EGVMLNTE- 242
                 .:.|...:...|.:.|.|.|||.:|..........:|..||.:.|.     .|:..|.: 
  Fly    74 -----DIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQT 133

  Fly   243 ---RLLKHAVQERQAITVCINKIDRLILELKLPPQDAYFKLKHIVEEVNGLLSTYGAPDDNLLVS 304
               .||...:..:|.| |.:||:|      ...|..:..:.:.|.:||:..:...|....::...
  Fly   134 REHALLAFTLGVKQLI-VGVNKMD------STEPPYSEARYEEIKKEVSSYIKKIGYNPASVAFV 191

  Fly   305 PILG 308
            ||.|
  Fly   192 PISG 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4849NP_651605.1 EFTUD2 4..111 CDD:292623
PTZ00416 115..957 CDD:240409 50/199 (25%)
Snu114p 132..340 CDD:206730 50/199 (25%)
Translation_Factor_II_like 477..568 CDD:295476
snRNP_III 589..660 CDD:293921
EF2_IV_snRNP 660..837 CDD:238840
eEF2_C_snRNP 832..911 CDD:239765
eEF1alpha2NP_524611.1 PTZ00141 1..450 CDD:185474 50/199 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464561
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.