DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4849 and eIF2gamma

DIOPT Version :9

Sequence 1:NP_651605.1 Gene:CG4849 / 43358 FlyBaseID:FBgn0039566 Length:975 Species:Drosophila melanogaster
Sequence 2:NP_001262587.1 Gene:eIF2gamma / 41843 FlyBaseID:FBgn0263740 Length:475 Species:Drosophila melanogaster


Alignment Length:225 Identity:53/225 - (23%)
Similarity:88/225 - (39%) Gaps:52/225 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 IKEQDMQETTYDMEFMADLMDTPPLIR-----NVALVGHLHHGKTTFVDCLIRQTHPQFETMEER 165
            :::||:  :..|:..:..|  :|.:|.     |:..:||:.|||:|.|..:......:|:...||
  Fly    14 LQKQDL--SNLDVSKLTPL--SPEVISRQATINIGTIGHVAHGKSTVVKAISGVQTVRFKNELER 74

  Fly   166 ----QLRYTDT-LFTEQERGCSIKATPVTLVLQDVKQKSYLL-----------------NIFDTP 208
                :|.|.:. ::......|...|:.|:    |...|...|                 :..|.|
  Fly    75 NITIKLGYANAKIYKCDNPKCPRPASFVS----DASSKDDSLPCTRLNCSGNFRLVRHVSFVDCP 135

  Fly   209 GHVNFSDEATAAM----RMSDGVVLFIDAAEGV--MLNTERLLKHAVQERQAITVCINKIDRLIL 267
            ||    |...|.|    .:.|..:|.|...|..  ...:|.|....:.:.:.|.:..|||| ||.
  Fly   136 GH----DILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIMKLKQILILQNKID-LIK 195

  Fly   268 ELKLPPQDAYFKLKHIVEEVNGLLSTYGAP 297
            |.:...|     .:.|.:.|.|.::. |||
  Fly   196 ESQAKEQ-----YEEITKFVQGTVAE-GAP 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4849NP_651605.1 EFTUD2 4..111 CDD:292623 1/4 (25%)
PTZ00416 115..957 CDD:240409 51/216 (24%)
Snu114p 132..340 CDD:206730 47/199 (24%)
Translation_Factor_II_like 477..568 CDD:295476
snRNP_III 589..660 CDD:293921
EF2_IV_snRNP 660..837 CDD:238840
eEF2_C_snRNP 832..911 CDD:239765
eIF2gammaNP_001262587.1 PTZ00327 11..465 CDD:240362 53/225 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464557
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.