Sequence 1: | NP_651605.1 | Gene: | CG4849 / 43358 | FlyBaseID: | FBgn0039566 | Length: | 975 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_610288.1 | Gene: | mEFTu2 / 35681 | FlyBaseID: | FBgn0033184 | Length: | 456 | Species: | Drosophila melanogaster |
Alignment Length: | 210 | Identity: | 60/210 - (28%) |
---|---|---|---|
Similarity: | 86/210 - (40%) | Gaps: | 31/210 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 133 NVALVGHLHHGKTTFVDCLIRQTHPQFETMEERQLRYTDTLFTEQERGCSIKATPVTLVLQDVKQ 197
Fly 198 KSYLLNIFDTPGHVNFSDEATAAMRMSDGVVLFIDAAEGVMLNT-ERLLKHAVQERQAITVCINK 261
Fly 262 ---IDRLILELKLPPQDAYFKLKHIVE-EVNGLLSTYGAPDDNLLVSPIL-GNVCFASSLYGFCF 321
Fly 322 TLKSFAKL--YADTY 334 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4849 | NP_651605.1 | EFTUD2 | 4..111 | CDD:292623 | |
PTZ00416 | 115..957 | CDD:240409 | 60/210 (29%) | ||
Snu114p | 132..340 | CDD:206730 | 60/210 (29%) | ||
Translation_Factor_II_like | 477..568 | CDD:295476 | |||
snRNP_III | 589..660 | CDD:293921 | |||
EF2_IV_snRNP | 660..837 | CDD:238840 | |||
eEF2_C_snRNP | 832..911 | CDD:239765 | |||
mEFTu2 | NP_610288.1 | PRK00049 | 53..437 | CDD:234596 | 60/210 (29%) |
EF_Tu | 56..249 | CDD:206671 | 60/210 (29%) | ||
EFTU_II | 257..343 | CDD:293898 | |||
mtEFTU_III | 347..437 | CDD:294005 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45464558 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |