DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4849 and F58G1.8

DIOPT Version :9

Sequence 1:NP_651605.1 Gene:CG4849 / 43358 FlyBaseID:FBgn0039566 Length:975 Species:Drosophila melanogaster
Sequence 2:NP_496753.1 Gene:F58G1.8 / 186541 WormBaseID:WBGene00010270 Length:83 Species:Caenorhabditis elegans


Alignment Length:55 Identity:10/55 - (18%)
Similarity:21/55 - (38%) Gaps:13/55 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   571 INVPEDLYIFRPLKFNTQSIIKIAVEPVNPSELPKMLDGLRKVNKSYPLLSTRVE 625
            |::||             ..|.:|::.||..:....:..|.:..|..|....:::
 Worm    39 IHIPE-------------PAISVALKSVNRKDADNFIKALTRFTKEEPTFRIKLK 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4849NP_651605.1 EFTUD2 4..111 CDD:292623
PTZ00416 115..957 CDD:240409 10/55 (18%)
Snu114p 132..340 CDD:206730
Translation_Factor_II_like 477..568 CDD:295476
snRNP_III 589..660 CDD:293921 7/37 (19%)
EF2_IV_snRNP 660..837 CDD:238840
eEF2_C_snRNP 832..911 CDD:239765
F58G1.8NP_496753.1 FusA <17..>79 CDD:357662 10/52 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0480
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.