DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4849 and F58G1.8

DIOPT Version :10

Sequence 1:NP_651605.1 Gene:CG4849 / 43358 FlyBaseID:FBgn0039566 Length:975 Species:Drosophila melanogaster
Sequence 2:NP_496753.1 Gene:F58G1.8 / 186541 WormBaseID:WBGene00010270 Length:83 Species:Caenorhabditis elegans


Alignment Length:55 Identity:10/55 - (18%)
Similarity:21/55 - (38%) Gaps:13/55 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   571 INVPEDLYIFRPLKFNTQSIIKIAVEPVNPSELPKMLDGLRKVNKSYPLLSTRVE 625
            |::||             ..|.:|::.||..:....:..|.:..|..|....:::
 Worm    39 IHIPE-------------PAISVALKSVNRKDADNFIKALTRFTKEEPTFRIKLK 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4849NP_651605.1 EFTUD2 4..111 CDD:464968
PRK13351 115..957 CDD:481252 10/55 (18%)
F58G1.8NP_496753.1 PRK12740 <28..>77 CDD:237186 10/50 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.