DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4849 and LOC110438493

DIOPT Version :9

Sequence 1:NP_651605.1 Gene:CG4849 / 43358 FlyBaseID:FBgn0039566 Length:975 Species:Drosophila melanogaster
Sequence 2:XP_021326691.1 Gene:LOC110438493 / 110438493 -ID:- Length:298 Species:Danio rerio


Alignment Length:265 Identity:91/265 - (34%)
Similarity:140/265 - (52%) Gaps:40/265 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 IRNVALVGHLHHGKTTFVDCLIRQTHPQFETMEERQLRYTDTLFTEQERGCSIKATPVTLVLQDV 195
            |||:.::.|:.|||||..|||: .::....:....:|||.|:...||.||.::|::.::|... .
Zfish    37 IRNLCILAHVDHGKTTLADCLV-ASNGIISSRLAGKLRYLDSREDEQIRGITMKSSAISLHFA-T 99

  Fly   196 KQKSYLLNIFDTPGHVNFSDEATAAMRMSDGVVLFIDAAEGVMLNTERLLKHAVQERQAITVCIN 260
            ....:|:|:.|:||||:||.|.:.|:|:.||.::.:||.|||...|:.:|:.|..|.....:.||
Zfish   100 GGVEFLINLIDSPGHVDFSSEVSTAVRLCDGAIVVVDAVEGVCPQTQVVLRQAWLENIRPVLVIN 164

  Fly   261 KIDRLILELKLPPQDAYFKLKHIVEEVNGLLSTY------------------------------- 294
            ||||||:||||..|:||..|:.|:|:||.:..|.                               
Zfish   165 KIDRLIVELKLTSQEAYVHLQKILEQVNAVTGTLFTSKVLEERAEKDAGSQSSFTENESGDHVYD 229

  Fly   295 ------GAPDDNLLVSPILGNVCFASSLYGFCFTLKSFAKLYADTYEGVAYLDFAKRLWGDMYFN 353
                  ...|.:|..||..|||.|||::.|:.|::..||::|:... |:......|.||||.|.|
Zfish   230 WSAGLEETDDSDLYFSPDRGNVVFASAIDGWGFSIHQFAEMYSQKM-GIRSSVLLKTLWGDFYLN 293

  Fly   354 SKTRK 358
            :|.:|
Zfish   294 AKAKK 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4849NP_651605.1 EFTUD2 4..111 CDD:292623
PTZ00416 115..957 CDD:240409 91/265 (34%)
Snu114p 132..340 CDD:206730 81/244 (33%)
Translation_Factor_II_like 477..568 CDD:295476
snRNP_III 589..660 CDD:293921
EF2_IV_snRNP 660..837 CDD:238840
eEF2_C_snRNP 832..911 CDD:239765
LOC110438493XP_021326691.1 EF2 38..272 CDD:206672 79/235 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140796at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.