Sequence 1: | NP_651605.1 | Gene: | CG4849 / 43358 | FlyBaseID: | FBgn0039566 | Length: | 975 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021326691.1 | Gene: | LOC110438493 / 110438493 | -ID: | - | Length: | 298 | Species: | Danio rerio |
Alignment Length: | 265 | Identity: | 91/265 - (34%) |
---|---|---|---|
Similarity: | 140/265 - (52%) | Gaps: | 40/265 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 131 IRNVALVGHLHHGKTTFVDCLIRQTHPQFETMEERQLRYTDTLFTEQERGCSIKATPVTLVLQDV 195
Fly 196 KQKSYLLNIFDTPGHVNFSDEATAAMRMSDGVVLFIDAAEGVMLNTERLLKHAVQERQAITVCIN 260
Fly 261 KIDRLILELKLPPQDAYFKLKHIVEEVNGLLSTY------------------------------- 294
Fly 295 ------GAPDDNLLVSPILGNVCFASSLYGFCFTLKSFAKLYADTYEGVAYLDFAKRLWGDMYFN 353
Fly 354 SKTRK 358 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4849 | NP_651605.1 | EFTUD2 | 4..111 | CDD:292623 | |
PTZ00416 | 115..957 | CDD:240409 | 91/265 (34%) | ||
Snu114p | 132..340 | CDD:206730 | 81/244 (33%) | ||
Translation_Factor_II_like | 477..568 | CDD:295476 | |||
snRNP_III | 589..660 | CDD:293921 | |||
EF2_IV_snRNP | 660..837 | CDD:238840 | |||
eEF2_C_snRNP | 832..911 | CDD:239765 | |||
LOC110438493 | XP_021326691.1 | EF2 | 38..272 | CDD:206672 | 79/235 (34%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D140796at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |