DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4884 and CG42487

DIOPT Version :10

Sequence 1:NP_651604.1 Gene:CG4884 / 43357 FlyBaseID:FBgn0039565 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001163752.1 Gene:CG42487 / 8674056 FlyBaseID:FBgn0259990 Length:309 Species:Drosophila melanogaster


Alignment Length:72 Identity:19/72 - (26%)
Similarity:28/72 - (38%) Gaps:26/72 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 KKSSRASDDLDSDDEDDEDFKDERDSKVVKTKVNSLRADLLLKAGLGMARNKVELNFYESKIRVN 112
            |:.|.:.:.::.:..||:||               |.|||         .|...|..|:  :|.|
  Fly   255 KEKSPSPEPMEVEPHDDDDF---------------LPADL---------HNYRPLTVYQ--VRPN 293

  Fly   113 GKKLPKK 119
            ..|.|||
  Fly   294 PDKKPKK 300

Return to query results.
Submit another query.